KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_02800Help
Entry
SCATT_02800       CDS       T02095                                 

Definition
(GenBank) Catalase
  KO
K03781  
catalase [EC:1.11.1.6]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCATT_02800
  Amino acid metabolism
   00380 Tryptophan metabolism
    SCATT_02800
Enzymes [BR:scy01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     SCATT_02800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
325635..327761
Genome map
AA seq 708 aa AA seqDB search
MHLMSVNPGQAGPGSLGNEPRDAKDEQLDRFRSAPRHDALTTDQGVRVDDTDNALRAGQR
GPTLLEDFHNREKITRFDHERIPERVVHARGAGAYGYFETTESLAEYTCADFLSEVGRRT
PVFVRFSTVQGPRGSADTVRDVRGFATKFYTREGNYDLVGNNMPVFFIQDAIKFPDFVHA
VKMEPHNEIPTGASAHDTFWDFCSLQPESTHMLMWLMSDRAIPRSFRMMQGFGVHTFRFV
TADGRGTFVKFHWKPKLGVHSLVWDETQLIAGRDPDFNRRDLWEAIEAGEYPEWELGVQL
VPEADEHKFDFDLLDATKIIPEELVPVRPVGRLVLDRNPQNFFAETEQVAFHTANVVPGI
DFTNDPLLQGRNFSYLDTQLIRLGGPNFAQLPVNRPVADVNNNHRDGYGQQVIHPGTNYF
PNSLGGGCPAHAGAGGAPGVFRHYQERVDGHKIRVRSESFQDHYSQATLFWNSMADWEKR
HIVQAFRFELGKCDSMAVRERMVGNLAHVHPDLAAGVAEGLGLPVPAAAGTVTGAASPAL
SQANLLGEGIRTRKVAVLAADGVEVPPLEEVRRELVGQGVIVEVLAASGGTLTGKDSGTL
KVDRALPTMASVLYDAVLVPGGDDAVATLAADPAAVRYVEEAYRHGKPLAALGSGSRLLA
AARLPEAVAGGAGRELGVFTSAGSGGVARDFAQALGRHRFPNRPGLLN
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
gtgcacctgatgtccgtcaatcctggccaggccggaccgggttccctcgggaatgagccc
cgtgacgccaaggacgagcagctggaccgcttccggtcggccccccggcacgacgcgctc
accaccgaccagggcgtgcgggtggacgacaccgacaacgcgctgcgggcggggcagcgc
gggccgacgctgctggaggacttccacaaccgggagaagatcacccggttcgaccacgag
cgcatcccggaacgggtggtgcacgcgcgcggggcgggcgcctacggctacttcgagacg
accgagtcgctggcggagtacacctgtgccgacttcctgtccgaggtgggccggcgtacc
ccggtgttcgtgcgcttctccaccgtgcaggggccgcgcggttccgccgacacggtgcgc
gacgtgcgcggcttcgccaccaagttctacacccgggaaggcaattacgacctggtcggc
aacaacatgccggtcttcttcatccaggacgccatcaagttcccggacttcgtgcacgcg
gtgaagatggagccgcacaacgagatccccaccggcgcctccgcgcacgacaccttctgg
gacttctgctcgctccagccggagtcgacgcacatgctgatgtggctgatgtcggaccgg
gcgatcccgcgcagcttccggatgatgcaggggttcggggtgcacacgttccggttcgtc
acggccgacgggcgcggcacgttcgtgaagttccactggaagccgaagctgggcgtccac
tcgctggtgtgggacgagacgcagctgatcgcggggcgggacccggacttcaaccggcgt
gacctgtgggaggcgatcgaggcgggcgagtacccggagtgggagctgggggtgcagctg
gtaccggaggcggacgagcacaagttcgacttcgacctgctggacgccacgaagatcatc
ccggaggagctggtgccggtgcgcccggtcgggcggctggtgctcgaccgcaacccgcag
aacttcttcgccgagaccgagcaggtggccttccacaccgccaacgtggtgccgggcatc
gacttcaccaacgacccgctgctccaggggcgcaacttctcctacctggacacccagctg
atccggctgggcggccccaacttcgcgcagttgccggtgaaccggccggtcgccgacgtc
aacaacaaccaccgggacggctacggccagcaggtgatccacccggggaccaactacttc
cccaactcgctgggcggcggctgcccggcgcacgccggggcgggcggcgcgccgggggtc
ttccggcactaccaggagcgggtcgacgggcacaagatccgggtgcgcagcgagagcttc
caggaccactacagccaggccacgctgttctggaacagcatggcggactgggagaagcgc
cacatcgtgcaggcgttccggttcgagctgggcaagtgcgactcgatggcggtgcgcgag
cggatggtgggcaacctggcccacgtccatccggatctggccgccggggtggccgagggg
ctcgggctgccggtgccggccgccgcgggaacggtcacgggtgccgcctcgcccgcgctc
agccaggccaacctgctcggtgagggcatccgtacccgcaaggtcgcggtgctggcggcg
gacggcgtggaggtgccgccgctggaggaggtgcgccgcgaactggtcggccagggcgtg
atcgtggaggtgctggcggcctccggggggacgctgaccggcaaggactccggcacgctg
aaggtggaccgggcgctgccgacgatggcctcggtgctctacgacgcggtgctggtgccc
ggcggtgacgacgcggtggcgacgctggcggccgatccggcggcggtgcgctacgtggag
gaggcctaccggcacggcaagccgctggcggcgctggggtccgggtcgcggctgctggcc
gcggcgcggttgccggaggcggtggccggcggggccggacgtgagctgggggtcttcacc
tccgcgggctccggcggcgtcgcgcgggacttcgcccaggcgctgggccggcaccgcttc
cccaatcgtcccgggctgctcaactga

DBGET integrated database retrieval system