KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_48370Help
Entry
SCATT_48370       CDS       T02095                                 

Definition
(GenBank) aminotransferase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SCATT_48370
   00650 Butanoate metabolism
    SCATT_48370
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCATT_48370
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCATT_48370
Enzymes [BR:scy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SCATT_48370
Amino acid related enzymes [BR:scy01007]
 Aminotransferase (transaminase)
  Class III
   SCATT_48370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5215256..5216584
Genome map
AA seq 442 aa AA seqDB search
MSPDSVHTALYARHRAVMPDWLATYYRAPIELTHGEGRHVQDAEGRRYLDFFGGILTTMT
AHALPEVTRAVAAQAGRVLHSSTLYLSRTAVELAERVARLSGIPDARVFFTSSGTEATDT
ALLLATAHRRSNQVLALRNSYHGRSFSAVGVTGNSAWSPTSLSPLQTYYVHGGVRTRGPF
AHLTDAEFTAACVADLEDVLGQTAGPVAALIAEPVQGVGGFTSPPDGLLAAFRRVLDRHG
ILWISDEVQTGWGRTGDHFWGWQAHAQAGPPDLLTFAKGLGNGLSIGGVVARAEVMNCLT
AGSISTFGGSPVTTAGALANLTYLLEHDLQGNARRVGGLLLTRLRAVAAGSPLVREVRGR
GLMIALELVRPGTGEPWGAAATEVLEAAREGGLLLGKGGREGNVLRIAPPLTLTVAEAEQ
GAAILAAALDRAGRRLDEEAVR
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgagccccgacagcgtccacaccgccctgtacgcccgccaccgggccgtcatgcccgac
tggctggccacctactaccgcgcccccatcgagctgacgcacggcgagggacgccacgtc
caggacgccgagggccgccgctacctggacttcttcggcggcatcctgaccaccatgacc
gcccacgcgctccccgaggtgacccgcgcggtcgccgcgcaggcgggccgcgtcctgcac
tcctcgacgctctacctcagccgcaccgccgtcgaactcgccgagcgcgtcgcacggttg
tccggcatccccgacgcccgggtcttcttcacctcctccggcaccgaggccaccgacacc
gcgctgctgctggccaccgcccaccgccgctccaaccaggtgctcgcgctgcgcaacagc
taccacggccgctccttctccgcggtcggcgtcaccggcaactccgcctggtcgccgacg
agcctgtccccgctgcagacgtactacgtgcacggcggggtgcgcacccggggcccgttc
gcgcatctgacggacgcggagttcaccgcggcgtgcgtggccgacctggaggatgtgctc
ggccagaccgcgggtccggtggccgcgctgatcgccgaaccggtgcagggcgtcggcggg
ttcaccagcccgcccgacggactgctggccgccttccgccgggtgctggaccgccacggc
atcctgtggatcagcgacgaggtgcagaccggctgggggcgcaccggcgaccacttctgg
gggtggcaggcgcacgcccaggccgggccgccggatctgctcaccttcgccaagggcctc
ggcaacgggctgtccatcggcggggtggtggcccgcgccgaggtgatgaactgcctgacc
gccggctccatctccaccttcggcggcagcccggtcaccaccgccggcgccctggccaac
ctcacctacctgctcgaacacgacctccagggcaacgcccgccgggtcggcggcctgctg
ctcacccggctgcgggcggtcgccgccggctccccgctggtccgcgaggtccgtggccgg
ggcctgatgatcgccctggaactggtgcgtcccggcaccggggaaccctggggcgcggcg
gcgaccgaggtgctggaggcggcccgcgagggcgggctgctgctcggcaagggcggccgg
gagggcaacgtgctgcgcatcgccccgccgctcaccctgaccgtggccgaggccgaacag
ggcgcggccatcctggccgccgccctggaccgggccggccgccggctcgacgaggaggcc
gtccgatga

DBGET integrated database retrieval system