KEGG   Sulfurospirillum deleyianum: Sdel_0345Help
Entry
Sdel_0345         CDS       T01126                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
sdl  Sulfurospirillum deleyianum
Brite
Translation factors [BR:sdl03012]
 Eukaryotic Type
  Elongation factors
   Sdel_0345
 Prokaryotic Type
   Sdel_0345
Mitochondrial biogenesis [BR:sdl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Sdel_0345
Exosome [BR:sdl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Sdel_0345
  Exosomal proteins of breast cancer cells
   Sdel_0345
  Exosomal proteins of colorectal cancer cells
   Sdel_0345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
325495..326694
Genome map
AA seq 399 aa AA seqDB search
MAKEKFSRTKPHVNIGTIGHVDHGKTTLTAAISAVLATKGLCEFKDYDGIDNAPEERERG
ITIATSHIEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFMNKADMVDDEELLELVEMEIRELLSSYDFPGDDTPIIAGSALKALE
EAKAGAVGPWGEKILALMAAVDAYIPEPVRETDKDFLMPIEDVFSISGRGTVVTGKIDRG
SVKIGETIEIVGIKDTKTTTVTGVEMFRKEMEQGQAGDNCGILLRGIKKEEVERGMVLCK
PKSITPHTDFEAEIYVLSKEEGGRHTPFFNNYRPQFYVRTTDVTGSISLPEGTEMVMPGD
NVKIKVALIAPIALEEGTRFAIREGGRTVGAGVVSAIIK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaagttctctagaaccaagccacacgttaacattggaaccatcggtcac
gttgatcatggtaaaactacattgacagctgcaatttctgctgttcttgctacaaaaggt
ctttgtgaatttaaagattatgatggtattgataacgctcctgaagagagagagcgtggt
attactattgcaacttcacacattgaatatgaaacagaaaatcgccattacgctcacgta
gattgtccaggccacgccgattacgttaaaaacatgattacaggtgctgcacaaatggac
ggtgctattcttgttgtttctgcagcagatggtcctatgccacaaactcgtgagcacatt
cttctttctcgtcaagtaggtgttccttatattgttgtattcatgaacaaagcagatatg
gttgatgatgaagaacttcttgaactcgttgaaatggaaattcgtgaacttcttagctca
tacgacttcccaggtgacgatactccaatcattgcaggttctgcgcttaaagcattagaa
gaagcaaaagcaggtgctgttggaccatggggtgaaaaaattcttgctcttatggcagca
gttgatgcgtatattccagagccagttcgtgagacagataaagacttcttgatgccaatc
gaagacgtattctcaatctcaggtcgtggcaccgttgttacaggtaaaatcgacagaggt
tctgttaaaattggtgagactatcgaaatcgtaggtattaaagatacaaaaacaacaaca
gtaactggtgttgaaatgttccgtaaagagatggaacaaggtcaagcaggcgataactgc
ggtatcttgttacgtggtatcaaaaaagaagaagttgagcgtggtatggttctttgtaaa
ccaaaatcaatcactcctcatactgattttgaagctgaaatctatgttctttcaaaagaa
gagggtggtagacatactccattctttaacaactatagaccacaattctatgtacgtaca
acagacgtaacaggttctatttcattgccagaaggtactgagatggttatgcctggtgat
aacgttaaaattaaagttgcacttatcgcacctatcgctcttgaagagggtactcgtttt
gcaatccgtgagggtggtagaactgttggtgcgggtgttgtttctgcaatcatcaagtaa

DBGET integrated database retrieval system