KEGG   Sulfuricella denitrificans: SCD_n02031Help
Entry
SCD_n02031        CDS       T02857                                 

Gene name
cbbL
Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
sdr  Sulfuricella denitrificans
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:sdr00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCD_n02031 (cbbL)
Enzymes [BR:sdr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     SCD_n02031 (cbbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2074039..2075460
Genome map
AA seq 473 aa AA seqDB search
MAVKTYNAGVKEYRQTYWTPEYTPLDTDILACFKITPQAGVPREEVAAAVAAESSTGTWT
TVWTDLLTDLDYYKGRAYRIEDVPGDDTCFYAFVAYPIDLFEEGSVVNVLTSLVGNVFGF
KALRALRLEDIRFPIAYVKTCGGPPQGIQVERDKMNKYGRPMLGCTIKPKLGLSAKNYGR
AVYECLRGGLDFTKDDENVNSQPFMRWRDRFEFVHEATMKAQRETGERKGHYLNVTAPTP
EMMYERAEFAKEIGAPIIMHDYLTGGLTANTGLANWCRKNGMLLHIHRAMHAVLDRNPHH
GIHFRVLTKVLRLSGGDHLHSGTVVGKLEGDREATLGWIDTMRDEFIKEDRSRGLFFDQD
WGSMPGVIPVASGGIHVWHMPALVNIFGDDSVLQFGGGTLGHPWGNAAGAAANRVALEAS
VAARNEGRNIEKEGKDILTKAAASSPELKIAMETWKEIKFEFDTVDKLDVAHK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaagacctacaacgccggtgtcaaagaataccggcaaacttactggacaccg
gaatacaccccgctggacaccgatatccttgcctgtttcaaaatcacgccacaggctggc
gtaccccgcgaagaagttgccgcagccgttgctgccgaatcttcaaccggcacctggacc
acggtgtggaccgatctgctgaccgacctggattactacaagggccgcgcctatcgcatc
gaggacgtacctggcgatgatacctgcttctacgccttcgtggcatacccgatcgacctg
ttcgaagaaggatccgtcgtcaacgttctgacttcgctggtgggcaacgtgttcggcttc
aaggcactgcgcgcattgcgtctggaagacatccgcttcccgatcgcctacgtcaagact
tgcggcggccctccccaaggtatccaggttgagcgcgacaagatgaacaagtatggccgt
ccgatgctgggctgcaccatcaagcccaagctgggtctgtccgccaagaactacggccgt
gctgtatacgagtgcctgcgcggcggtctggacttcaccaaggatgacgagaacgtcaac
agccagccgttcatgcgttggcgcgaccgtttcgaattcgtacacgaagccaccatgaaa
gctcagcgcgaaaccggcgagcgcaagggccactacctgaacgtcaccgctccaacacca
gaaatgatgtacgagcgtgccgagtttgccaaggaaatcggcgcaccgatcatcatgcac
gattacctcaccggcggtttgacagccaacacgggtctggctaactggtgccgcaagaac
ggcatgctgttgcacatccaccgcgccatgcacgccgtgctggatcgcaacccgcaccac
ggtattcacttccgcgtcttgaccaaagtactgcgcctgtccggtggcgaccacctgcac
tccggtaccgtggtgggcaagctggaaggcgaccgcgaggctaccttgggctggatcgac
accatgcgtgatgaattcatcaaggaagatcgcagccgtggcctgttcttcgatcaggac
tggggctccatgcccggcgtgatcccggttgcttccggcggtatccacgtctggcacatg
cctgcactggtcaacatcttcggtgacgactcggtgttgcagttcggcggcggcacgctg
ggtcacccctggggtaacgcagccggcgcagcagccaaccgtgtcgcactggaagccagc
gtggcagcgcgtaacgaaggccggaatatcgaaaaagaaggcaaagatatcctgaccaag
gcagccgccagcagccctgaactgaaaatcgccatggaaacatggaaagagatcaagttc
gagttcgacaccgtcgacaaactggacgtggcacataaataa

DBGET integrated database retrieval system