KEGG   Streptococcus dysgalactiae subsp. equisimilis GGS_124: SDEG_0621Help
Entry
SDEG_0621         CDS       T00932                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sds  Streptococcus dysgalactiae subsp. equisimilis GGS_124
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sds00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SDEG_0621 (ppc)
  Energy metabolism
   00680 Methane metabolism
    SDEG_0621 (ppc)
Enzymes [BR:sds01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SDEG_0621 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:588677..591508
Genome map
AA seq 943 aa AA seqDB search
MLSFLVKSGMIKREANRGGVNSLSLKKLESSNNQAIIAEEVAILKDMLEKITRRMIGDEA
FATIETIVALSEKQDYVGLETIIASISNQDMDVISRYFSILPLLINISEDVDLAYEINYQ
NNANKDYLGKLALTIDAVAEKENAKDILEQVNVVPVLTAHPTQVQRKTILELTTHIHDLL
RKYRDVKAGVVNQEKWHNELYRYIEIIMQTDIIREKKLKVKNEITNVMQYYNGSLIQAVT
KLTTEYKNLAQKRGLDLVNPNPITMGMWIGGDRDGNPFVTAETLRLSATVQSEVILNYYI
EKLAALYRTFSLSSTLIQPSAEVERLASLSQDQSIYRENEPYRRAFHYVKSRLVQTRTQL
TGDQDTTGQSLTAGRLTRQLAMQDQLEGPIAAYVSPEDFKADLMAIEQSLLSNGDVALVD
GDLREVMQAVDIFGFFLASIDMRQDSSVQEACVAELLKGANIVEDYSSLSETEKCDLLVK
QLTEDPRTLSSAAVAKSDLLEKELAIYAAARELKDKLGDEVIKQHIISHTESVSDMFELA
IMLKEVGLIDQHKARVQIVPLFETIEDLDNARDIMTTYLSYDMVKSWIAANHNYQEIMLG
YSDSNKDGGYLASGWTLYKAQNELTAIGEENGVKITFFHGRGGTVGRGGGPSYDAITSQP
FGSIKDRIRLTEQGEIIENKYGNKDVAYYHLEMLISASINRMVTQMLTNPNEIDGFREVM
DGIVADSNKIYRQLVFDNPHFYDYFFEASPIKEVSSLNIGSRPAARKTITEITGLRAIPW
VFSWSQNRIMFPGWYGVGSAFKHYIDQAEGNLERLQHMYQTWPFFHSLLSNVDMVLSKSN
MNIAFQYAQLADSQEVRDVFHVILDEWQLTKNVILAIEGHEELLEDNPSLKQSLAFRLPY
FNVLNYIQIELIKRLRNHQLREEDEKLIHTTINGIATGLRNSG
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
gtgctttcatttctagtaaaaagtggtatgataaaaagagaagctaacagaggaggagtc
aatagtttgtcacttaaaaagctagagagtagtaacaaccaagctattattgctgaggaa
gttgctattttaaaagatatgttggaaaaaatcacccgtcgaatgattggagatgaggcg
ttcgcaacgattgaaaccattgttgctttatctgaaaagcaagattacgttgggttagaa
acgattatcgcaagcatttctaatcaagatatggatgtgatttcaagatacttttcaatc
ttgcctctgttaattaacatttcagaagatgtggatttggcttatgaaatcaattatcaa
aataatgccaacaaggattatttaggcaaacttgccttaactattgatgccgtcgcagaa
aaagagaatgccaaagacatcttagagcaggttaatgtggtacctgttttgacagcccat
ccgacacaagtgcagcgcaagaccattttggagttgacaacgcatatccatgatctcctt
cgtaagtatcgtgatgtcaaagctggtgtcgttaaccaagagaagtggcataatgaactc
tatcggtacatagaaatcattatgcagacagatattatccgcgagaaaaaactcaaggtc
aaaaatgagattactaacgtcatgcagtattacaatggttctctcattcaagcagtgacc
aaattaacaactgagtataaaaacttggctcagaaacgtggcttagacttggtcaatcct
aaccccataaccatgggcatgtggattggaggagatagggatgggaatccttttgtcaca
gctgaaaccctaaggttatctgctacggttcagagcgaagtcatcctgaattattatatt
gaaaaattagcagccctttaccgaaccttttctttgtcgtctaccttaattcaaccgagt
gcagaagtagagcgtctggctagcttatcccaagaccagtctatttaccgtgaaaatgaa
ccttaccgtagggcttttcattatgtgaagtcccgccttgtccaaacacgcactcaattg
acaggggaccaagatactactggacagtcgctcacagcgggtcgccttactcgtcagtta
gcaatgcaagatcagttagaaggacctattgctgcctacgtttcgccggaagactttaaa
gctgatttgatggccattgagcaatctcttttaagcaatggtgatgttgcactggttgat
ggcgacttacgcgaagtgatgcaagctgttgatatttttggcttcttcctagcaagtatt
gacatgaggcaagactctagtgtgcaagaagcatgtgtggcagagttattaaaaggagct
aatatcgttgaggattatagctcactttcagaaactgaaaaatgtgatcttcttgtgaaa
caactgacagaggatccaagaacactatcttcagcagcagttgctaagtcagatttgctc
gaaaaagaattagcgatttacgcagctgcacgtgagttgaaggataagctaggtgatgag
gtcattaagcagcacatcatttcgcacacagaaagtgtttctgatatgtttgaattggcc
atcatgctcaaagaagttggtctgattgaccaacacaaagctcgtgtgcaaattgtgcca
ctttttgaaactattgaagacttagacaatgctcgtgacattatgacaacttacttgagt
tatgatatggttaaatcatggattgcagctaatcataactatcaagaaattatgttaggt
tattctgacagtaataaagatggtggttaccttgcttcaggttggaccctctataaagct
caaaatgaattaacagccattggagaggaaaatggcgtgaaaatcactttcttccatggt
cgtggaggaacagttggacgaggcggtggaccttcttacgatgccatcacctcacaacct
tttggttctattaaagatcgcattcgcctcactgaacaaggggagattattgaaaataaa
tatggtaataaagatgtcgcttattaccatttagaaatgctcatttcagcttctattaat
cgtatggtcacacaaatgcttaccaaccctaatgaaattgacggattcagagaagtcatg
gatggtattgttgcggacagtaataagatttaccgccagctagtatttgataatcctcat
ttttacgattatttctttgaagcaagtcctatcaaggaagtttctagccttaacataggg
tcaagaccggcagcccgtaaaacgattacggaaatcacaggcttgcgggctattccttgg
gtcttttcgtggtcacaaaatcgtatcatgttccccggatggtatggggtaggatcggcc
tttaaacattatattgaccaagcagaaggcaatcttgagcgtctccaacacatgtaccag
acttggcccttcttccattccttattatcgaatgtggatatggtgctatcgaaatcaaat
atgaacatcgcttttcaatatgctcagttggcagacagccaagaggttagggatgttttt
catgtgattttggacgaatggcagttgacaaaaaatgtgattcttgccatcgaaggacat
gaggagttactagaagataacccatctttgaaacaaagtttagcttttcgtctcccttat
ttcaatgtgttgaactatattcaaattgaattgattaagcgcctgcgcaatcatcagtta
agagaagaggatgaaaaattaattcacacaacgattaatggaattgcgactgggttacgt
aattcaggctaa

DBGET integrated database retrieval system