KEGG   Streptomyces davawensis: BN159_1361Help
Entry
BN159_1361        CDS       T02518                                 

Definition
(GenBank) AMP-binding domain-containing protein
Organism
sdv  Streptomyces davawensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1474290..1476098
Genome map
AA seq 602 aa AA seqDB search
MPHQLQYRTMTDAVRTGVERHPERPAFVYLHEDGPDMRPEQLSYAELDRRARSVATRLQH
ASQQDRSRPVLLLYPPTLDFVTAFLGCFYAGRTAIPAPLPDEPGERLARVHGILRDADVG
AVLTLPKYRQAIAAWLAAAGEQDVLCLATGADAEETADPDLWTPPRVRDTDVAFLQYSSG
STSEPKGVMVTHANLAANEEAIRGAMVTPDGVVAGSWLPLYHDMGLIGMTLQPLWVGGTS
VQMSPIAFIKQPHRWLRMIHDYRVEGTASPNFGYELCTRRVTEEQSADLDLSSLRVALNG
AEPVRAETLRAFVGRFAGNGLRPQAIRPCYGLAENTLLVSSGDTEAPHLELTVDARALEQ
DELRPARSDRADRTLVGCGRPKDTEVLIVDPVTLRVLPDGQVGEIWLRGRSVASGYWNRK
ELTAETFRAVTADGRAGYFRTGDLGALLDEELYVTGRIKEMLIQHGRNLYPQDIEQAVQE
SGEAFRRGGGAVFTVTDEASERAHVVVVQELRAPAVEAADLVQLGASVQSLISRQFQLPA
VSVVLVRPGAIRRTTSGKTQRTLMRRLFLDGSLPVLHQRLQPPVAALVTAPGEAPEPAVT
RR
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
gtgccacaccagcttcagtaccggacgatgacggacgccgtacgcaccggcgtggaacgc
catcctgagcggcccgcgttcgtgtacctgcacgaggacggcccggacatgcggcccgag
cagctcagctacgccgaactggaccgccgggcccgctcggtggccaccaggctccagcac
gcgtcccagcaagaccgctcgcgtccggtcctgctgctctacccgccgaccctggacttc
gtcacggcctttctcggctgcttctacgcggggcgcaccgccatccccgcacccctgccc
gacgagccgggcgaacgactggcccgggtccacgggatcctgcgggacgccgacgtgggc
gcggtgctgaccctgccgaagtaccggcaggccatcgcggcctggctggccgcagcggga
gagcaggacgtgctgtgcctggcgaccggcgcggacgccgaggagacggccgaccccgac
ctgtggaccccgccccgcgtacgcgacacggatgtggccttcctccagtacagctccggc
tccaccagcgagccgaagggcgtcatggtcacgcacgccaacctcgccgccaacgaggag
gccatccgcggcgccatggtgaccccggacggcgtggtggccggcagctggctgccgctc
taccacgacatggggctcatcggcatgaccctgcaaccgctgtgggtgggcggcaccagc
gtgcagatgtccccgatcgccttcatcaaacaaccgcaccgctggctgcgcatgatccac
gactaccgggtcgagggcaccgcatcccccaacttcggctacgaactgtgcacccgccgc
gtcaccgaggaacagtccgccgacctggacctgtccagcctgcgggtggccctcaacggg
gccgagccggtgcgcgccgagaccctgcgcgccttcgtcggccgcttcgcgggcaacggg
ctgcgtccgcaggcgatccggccctgttacggcctggcggagaacaccctgctggtctcc
agcggcgacaccgaggccccccacctcgaactcaccgtggacgcccgcgccctggagcag
gacgagctgcggcccgcccgtagcgaccgtgccgaccgcaccctggtcggctgcggccgg
ccgaaggacaccgaggtgctgatcgtggacccggtgaccctgcgggtgctgcccgacggc
caggtcggcgagatctggctgcgcggccgatcggtggcctccggctactggaaccggaag
gagctcaccgccgagaccttccgggccgtgacggcggacggccgcgcgggctactttcgc
accggtgatctcggggccctgctcgacgaggagctctacgtcaccgggcggatcaaggag
atgctgatccagcacggccgcaacctctacccgcaggacatcgagcaggccgtacaggag
tccggggaggcgttccggcgcggcggaggcgcggtgttcaccgtcaccgacgaggcgtcc
gagcgcgcgcacgtggtcgtggtgcaggagttgcgggcccccgccgtcgaggcagcggac
ctggtccaactcggcgcctcggtccagtccttgatcagccgtcagttccagttgcccgcc
gtgagcgtggtgctggtgcgccccggagcgatccgtaggaccaccagcggcaagacgcag
cgcaccctcatgcggcggctcttcctcgacggcagcctgccggtgctgcaccagcggctt
cagccgccggtcgccgccctggtcaccgccccgggcgaggcaccggagcccgccgtcacc
cgtcgctga

DBGET integrated database retrieval system