KEGG   Streptomyces davaonensis: BN159_1504Help
Entry
BN159_1504        CDS       T02518                                 

Gene name
icd
Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sdv  Streptomyces davaonensis
Pathway
sdv00020  Citrate cycle (TCA cycle)
sdv00480  Glutathione metabolism
sdv01100  Metabolic pathways
sdv01110  Biosynthesis of secondary metabolites
sdv01120  Microbial metabolism in diverse environments
sdv01130  Biosynthesis of antibiotics
sdv01200  Carbon metabolism
sdv01210  2-Oxocarboxylic acid metabolism
sdv01230  Biosynthesis of amino acids
Module
sdv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sdv_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sdv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN159_1504 (icd)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BN159_1504 (icd)
Enzymes [BR:sdv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BN159_1504 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: CCK25883
UniProt: K4QXV5
LinkDB All DBs
Position
1634278..1636497
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVVQAYASQAGVAVETRDISLAGRIIAVFPEYLTEDQ
RIPDALAELGELAKTPAANIIKLPNVSASVPQLKAAIAELQGQGYALPNYPDDPKTDEER
EIQARYDKIKGSAVNPVLREGNSDRRAPASVKNYAKTHPHRMGAWTGESKTNVATMSEND
FAATEKSVVIAEDTTLSFELVGADGSATALRAPLKVIAGEVVDASVLRVAALREFLTAQV
ARAKAEGVLFSVHLKATMMKVSDPIVFGHVVRAFFPKTFAQYGEVLAGAGLSPNDGLGAI
LKGLESLANGAEIKASFEAEIADGPALAMVDSDKGITNLHVPSDVIVDASMPAMIRTSGH
MWGPDGQEADTLAVLPDHSYSGVYQAVIEDCRANGAYDPSTMGSVPNVGLMAQKAEEYGS
HDKTFEIPADGTVRLVDAAGNVVLEQAVAAGDIFRACQTKDAPIRDWVKLAVTRARATGD
PAVFWLDENRGHDAVIIEKVKAYLPEHDTEGLDIQILSPVEATKFSIERIRRGENTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFFALVPSLEQYAKSTGNARAQVLADTLDRATATFLNEDKSPTRRVGGIDNRGSHFF
LSLYWAQELAKQTDDAELAKAFAPLAETLAANEQKIVEELISVQGSPAEIGGYYQPDPAK
AAAVMRPSATWNEALASLS
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctatacgcacactgacgaggccccggccctggcgacgtat
tccttcctgccggtggtccaggcgtacgcctcgcaggcgggtgtcgccgtggagacgcgg
gacatctcgctggccggccgcatcatcgcggtgttcccggagtacctgaccgaggaccag
cggatcccggacgcgctcgccgagctgggtgagctggccaagaccccggccgccaacatc
atcaagctgccgaacgtctcggcgtccgtcccgcagctgaaggccgcgatcgccgagctc
cagggccagggctacgcgctgccgaactacccggacgacccgaagaccgacgaggagcgg
gagatccaggcccgctacgacaagatcaagggttccgcggtgaacccggtcctgcgcgag
ggcaactccgaccgccgcgcccccgcctcggtcaagaactacgccaagacccacccgcac
cgcatgggcgcctggaccggcgagtccaagacgaacgtggcgacgatgagcgagaacgac
ttcgccgccaccgagaagtccgtggtgatcgccgaggacaccaccctcagcttcgagctg
gtcggcgccgacggctccgccaccgccctgcgcgccccgctcaaggtcatcgccggtgag
gtcgtcgacgcctccgtgctgcgggtcgccgcgctgcgcgagttcctcacggcgcaggtc
gcccgcgccaaggcggagggtgtgctgttctccgtgcacctgaaggccacgatgatgaag
gtctccgacccgatcgtcttcggccatgtcgtccgcgcgttcttcccgaagaccttcgcg
cagtacggcgaggtcctggccggcgccggtctgtccccgaacgacggtctgggcgccatc
ctcaagggcctggagtccctggcgaacggcgccgagatcaaggcctccttcgaggcggag
atcgccgacggcccggccctggcgatggtcgactccgacaagggcatcaccaacctgcac
gtgccgtccgacgtgatcgtcgacgcctcgatgccggccatgatccgcacctccggccac
atgtggggcccggacggccaggaggccgacaccctcgcggtgctgccggaccactcctac
tccggtgtctaccaggccgtgatcgaggactgccgggccaacggcgcctacgacccgtcg
acgatgggctcggtcccgaacgtcggcctgatggcgcagaaggccgaggagtacggctcc
cacgacaagaccttcgagatcccggccgacggcacggtccgcctggtcgacgcggccggc
aatgtcgtcctggagcaggccgtcgccgccggtgacatcttccgcgcctgccagaccaag
gacgccccgatccgcgactgggtcaagctggccgtcacccgcgcccgcgccaccggtgac
ccggcggtgttctggctggacgagaaccgcggccacgacgccgtgatcatcgagaaggtc
aaggcgtacctgccggagcacgacaccgagggcctggacatccagatcctctctccggtc
gaggccaccaagttctccatcgagcgcatccgccgcggcgagaacaccatctcggtcacc
ggcaacgtgctgcgtgactacctgaccgacctcttcccgatcctggagctgggcaccagc
gccaagatgctgtcggtcgtcccgctgatggcgggcggcggtctgttcgagacgggcgcc
ggcggttccgcgccgaagcacgtccagcagctggtcaaggagaactacctgcgctgggac
tcgctcggtgagttcttcgcgctggtcccgtccctggagcagtacgcgaagagcacgggc
aacgcccgcgcccaggtcctggccgacaccctggaccgcgccacggcgaccttcctcaac
gaggacaagtccccgacccgtcgcgtcggcggcatcgacaaccgcggcagccacttcttc
ctgtccctgtactgggcgcaggagctggccaagcagaccgacgacgcggagctcgcgaag
gccttcgccccgctcgccgagacgctcgcggcgaacgagcagaagatcgtcgaggagctg
atctcggtccagggctccccggccgagatcggcggctactaccagcccgacccggcgaag
gcggccgcggtcatgcgcccgtcggcgacctggaacgaggcgctggcgtccctcagctga

DBGET integrated database retrieval system