KEGG   Streptomyces davawensis: BN159_3067Help
Entry
BN159_3067        CDS       T02518                                 

Definition
(GenBank) DNA polymerase LigD, polymerase domain-containing protein
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sdv  Streptomyces davawensis
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sdv00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    BN159_3067
Enzymes [BR:sdv01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BN159_3067
DNA repair and recombination proteins [BR:sdv03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BN159_3067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3489666..3490553
Genome map
AA seq 295 aa AA seqDB search
MTPITEVEGRRLALSNLEKVLYPATGFTKGEVLHYYATAADVLLPHLRDRPVSFLRYPDG
PDGQVFFTKNVPPGTPDWVTTAEVPRSEGPARMVLVQDLPSLMWAANLVAEFHTHQWVAQ
APGAADRLVFDLDPGSPATVVECCEVALWLRERLAADGIEAYAKTSGSKGLHLLAAVRGS
PSDEVSEYAKGLAVEAEKAMPRLVLHRMTRSLRPGKVFVDWSQNAARKTTATPYTLRARP
EPWVSAPVTWAEVEECRSPTQLAFTAPDVAPRIQDYGDLLAPLFAQDRAGTLPRS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgatcacagaggtggaggggcgacggctcgcgctcagcaacctggagaaggtg
ctgtacccggcgaccggcttcaccaagggcgaggtgctgcactactacgccaccgccgcc
gacgtactgctgccccatctgcgtgaccggccggtctccttcctgcgctacccggacggg
ccggacggacaggtcttcttcaccaagaacgtgccgcccggtacacccgactgggtcacc
accgccgaggtcccccgttcggaggggcccgcccggatggtgctcgtccaggacctcccg
agcctgatgtgggcggcgaacctggtcgccgagttccacacccaccagtgggtcgcccag
gcgcccggcgccgccgaccggctcgtcttcgacctcgacccgggttccccggcgaccgtc
gtggagtgctgcgaggtcgccctgtggctgcgcgagcggctcgccgcggacgggatcgag
gcgtacgccaagacgtccgggtccaaggggctgcatctgctcgcagcggtccggggttcc
ccctccgacgaggtgtccgagtacgccaaggggctcgccgtggaggccgagaaggccatg
ccgcggctggtgctgcaccggatgacgcgcagcctgcggccggggaaggtcttcgtcgac
tggagccagaacgccgcccggaagacgacggccacgccctacaccctccgcgcccgcccc
gagccctgggtctccgcgcccgtcacctgggccgaggtcgaggagtgccgctcccccacc
cagctggccttcaccgcaccggacgtggccccgcgcatccaggactacggcgatctgctg
gcgccgctcttcgcccaggaccgggcggggacgctgccgcgaagctga

DBGET integrated database retrieval system