KEGG   Streptomyces davawensis: BN159_3168Help
Entry
BN159_3168        CDS       T02518                                 

Definition
(GenBank) hypothetical protein
Organism
sdv  Streptomyces davawensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3589071..3594866
Genome map
AA seq 1931 aa AA seqDB search
MNTPLSTLSRSLVDLLRTRAAQQPERQAYVFLDSHGRAENALTYAQLDRQARRVAATLRA
TCSPGDRVLILYPPGAEYVSAFLGCLYAGTVAVPSPPPHARNAARLRAIAADAQPAAALT
GDRALAAVRKRLPELAEMAWLSTGDLTADPESWTDPGADGDSLAFLQYTSGSTAVPKGVM
VTHGNLLHNSAQIQRRTRAGEESRLVSWLPPFHDMGLIGGILQPLFGGFPGVLMAPGTFV
LDPAQWLRAISDHAATVSAVPPFALDLCVERVDPGTHEPLDLSTLDTVIVGAEPVPAACL
DRFAEHFAPWGMRRSALRPSYGLAEATLMVSCGDRLTASSALTLDAAALEAHRVEPGGAG
QRRTVVGCGSSVDGQRLLVVDPADGTPSGPGQVGEVWVGGPSVARGYWNRPEESATVFGA
RTASGEGPFLRTGDLGFLRDGELFITGRSKDLIIVRGRNLYPQDIERCAESAHPALRPHA
TAAVAVDPGDGTERLVVVAEVRRGVEPPPVAEVAREVGRAITAEFDVRLHRLVLVRPSTV
PKTSSGKIRRRGTRAALVAGSLGVVAEWTAVPEVGEVETYLTGLVASLVPGARRPGREEP
LLDLGLDSLAMLRLAGRIERDLGVSVAEDLLHDAPTVAALAAALGDQPRSGPGTAPLAED
DPYAPFPQTDTQQAYCLGRTGAFELGNVSTHVYVEFDAPELDLNRFERAWRRVIDRHEML
RAVMLPDSNEQRILPEVPPYEIRVTDLRGLEKGAAEAELAAVRERLSHEVRPADRWPLFE
VTASRLDDGLRVHLSIDSLIADFSSGRLLFDDLSRFYGEPEAQPPAPARSFRDHVRAEAE
RTGTPEYRRAHDYWWSRLPELPPAPQLPTRSATVDAPRFTRRETVLSAATWRSLKARAAR
AGLTPSGLLLAVYAETLATWSNSRHFTLNVPRLTRPVRDPSYDEVLGQFASFTLLEVDHR
GAGTFLERAQAVQRRLRSDLRHSAVSGVEVLRELMRLQGGYDRALMPVVMTSNLAFAAET
PTALEQLLTPVFTISQTPQVTLDCQAHERSGALLLNWDSVDELFPAGLVDAMFDAQTALL
HRLATAEDTWSGTAPLPLPEQRHPDTGPERSVPDLQVQQLFERQVALRPDAPAVIAPDLT
LSYAALADASRQVARWLRAHGARPGHLVAVVMEKGWEQAVAAYAVLFSGAAYLPIDPDLP
VRRIRQLLERGEVGLVLTQSQLTLDWPDGLLRLCLDQPLPADTETPLPAPGSPDDVVCTL
FTSGSTGEPKGVRITHRALVNCLLDTLDTHRITEADRCLAVTALHHDLSAFDLFGMLGAG
GAMVVPAAADRRDPAHWAELIARNGVTVWISVPAMMEMLLESGARPDSLRLAFLGGDWIP
LPVPGRLKDLVPGVEVVSIGGPTETTVWSIWYPIAGIDPDWRSIPYGTPLANVRYRVLDD
RLRDCPDWVTGEMYVSGVCLADGYWRDPDRTEAAFVRHPETGERMYRTGDLGRWRPEGTL
EFMGRADFQVQIRGQRIEPGEIEAALLAHPDVTSAVVTATAHADRPGHDGLVAYVIPNES
TDAAAFEADRRTGITLLDPLARAEFKLARHGLRREPGRQRLPLPRVPAEPSRRRSDRAFL
PEPVTLPELSACLGLLEQDEVDGLAKCRYPSAGGLYPVQAYVQVKSVAGLAPGAYYVDPG
QNALVPLAEGTRVGAEVHARHNRALVDAAGFTLFLVADLDAIEPMYGTLARDLCLLEAGY
MGQLLMDWAAGTDVGLCPIGELDFEPLKPEFALGERHVLAHALVGGRVDRTAADPAAASL
PDRLRGWLRERLPAHMVPEHVLLLDSWPLSANGKVDRRRLPAPRHTGPANGYVAPRTATE
QQLATLWCEVLDVPRVGIQDNFFDLGGHSLAATRLIARIRDRFEISIGLREVFTTRTVAD
LASAVDRRRER
NT seq 5796 nt NT seq  +upstreamnt  +downstreamnt
atgaacacacccctgagcaccctctcccgcagcctcgtcgacctgctgcgcacccgcgcg
gcgcagcagcccgaacgccaggcctacgtcttcctcgacagccacggcagagcggagaac
gccctcacctacgcgcagttggaccgccaggcccgccgggtggccgcgaccttacgggcc
acgtgctcgcccggtgaccgggtgctgatcctctacccgccgggcgccgagtacgtgagc
gcgttcctcggctgtctgtacgccgggaccgtcgccgtaccgtcccctcccccgcacgcc
cgcaacgcggcccggctcagggccatcgccgcggacgcgcagcccgctgccgcgctcacc
ggtgaccgggccctggccgccgtccgcaagcggctgccggaactggcggaaatggcctgg
ctgtcgaccggcgacctgaccgccgatccggagtcctggacggacccgggcgcggacggc
gacagcctcgccttcctccagtacacctcgggcagcaccgccgtcccgaagggcgtgatg
gtcacgcacggcaacctgctgcacaactccgcccagatccagcggcgcacccgggccggg
gaggagtcccggctggtcagctggctgccgccgttccacgacatggggctcatcggcggc
atcctccagccgctcttcggcggcttccccggggtgctgatggcaccgggcaccttcgtc
ctggaccccgcgcagtggctgcgcgcgatctccgaccacgccgccacggtgtccgccgta
ccgccgttcgccctggacctgtgcgtggagcgcgtcgaccccggcacgcacgagccgctc
gatctgagcaccctggacacggtcatcgtcggcgcggagccggtgccggccgcctgtctc
gaccggttcgccgagcacttcgccccctggggcatgcgccggtccgccctgcgccccagc
tacggtctcgccgaggccacgctgatggtgtcctgcggcgaccggctcaccgcctcgtcg
gcgctcacgttggacgctgccgcgctggaggcgcaccgggtcgagccgggcggggcgggg
cagcggcggacggtggtcggctgcgggagctccgtggacggacagcggctgctcgtcgtc
gatccggccgacgggacgccgagcgggcccggacaggtcggggaggtctgggtcggcggg
ccgagcgtcgcgcgcgggtactggaaccggcccgaggagagcgcgacggtcttcggcgcg
cgcacagcgagcggcgagggcccctttctgcgcaccggggacctcgggttcctgcgcgac
ggcgagctgttcatcaccggccgcagcaaggacctcatcatcgtgcgcggccgcaatctg
tacccacaggacatcgagcggtgcgcggagagcgcccatccggcgctgcggccccatgcc
acagcggccgtcgcggtggacccgggcgacggcacggaacggctggtcgtggtggccgag
gtgcggcgcggggtggagccgccgccggtggccgaggtcgcgcgggaggtcggccgggcg
atcaccgcggagttcgacgtacggctgcaccggctcgtcctggtccggccgtcgaccgtg
ccgaagacctccagcggcaagatccggcgccgggggacccgcgcggccctcgtcgccggg
tccctcggcgtcgtcgccgagtggacggccgtacccgaggtgggcgaggtggagacgtat
ctgaccggcctggtcgcctcgctcgtcccgggggcacgacgccccggacgcgaggagcct
ctcctcgacctcggcctggactccctggccatgctgcggctcgcggggcgcatcgagcgg
gatctcggggtgtccgtcgccgaggacctgctccacgacgccccgaccgtcgcggcgctg
gcggcggcactcggggaccagccgaggtccgggcccggaaccgcgccgctcgccgaggac
gacccgtacgcccccttcccgcagaccgacacccagcaggcgtactgcctcggccgcacc
ggcgccttcgaactcgggaacgtctccacgcatgtgtacgtcgagttcgacgcccccgaa
ctcgacctgaaccgcttcgagcgggcctggcggcgggtgatcgaccggcacgagatgctg
cgggcggtgatgctgccggacagcaacgagcagcggatcctgcccgaggtgccgccgtac
gagatccgggtgaccgatctgcgcggtctggagaagggggcggccgaggcggagctggcg
gcggtccgggagcggctgtcgcacgaggtgcggcccgccgaccggtggccgctgttcgag
gtgaccgccagccggctggacgacggactgcgcgtccatctcagcatcgactcgctgatc
gccgacttctcctccggccggctgctcttcgacgacctgtcccgcttctacggcgaaccg
gaggcccaaccgcccgcccccgcccgctccttccgcgaccatgtgcgcgccgaggcggag
cggaccgggacccccgagtaccggcgcgcccacgactactggtggagccgcctgcccgaa
ctgcccccggcaccccagctgcccacccgctccgcgacggtggacgcacctcggttcacc
cgccgggagaccgtcctgtccgccgcgacctggcggagcctgaaggcgcgggcggcacgg
gccgggctgaccccgagcgggctgctgctcgcggtgtacgcggagacgctggccacctgg
agcaacagccgccacttcacactcaacgtgccgcggctgacccgtccggtgcgggatccc
tcgtacgacgaggtgctcggccaattcgcctccttcaccctgctggaggtcgaccaccgc
ggcgccgggaccttcctggagcgggctcaagcggtgcagcgccgactccggtccgatctg
cggcactcggccgtcagcggagtggaggtgctgcgcgagctgatgcgcctccagggcggc
tacgaccgggccctgatgccggtggtgatgacgagcaacctcgccttcgccgccgagacc
ccgaccgcgctggagcagctgctcaccccggtgttcaccatctcccagaccccgcaggtc
accctggactgccaggcccacgaacggtcgggagcgctgctgctgaactgggactcggtg
gacgaactgtttcccgccgggctggtcgacgccatgttcgacgcccagacggccctgctg
caccggctcgccaccgccgaggacacctggtccggcaccgcgccgctccccctgccggag
cagcgccacccggacacgggccccgagcgttccgtaccggatctccaggtgcagcagctc
ttcgagcggcaggtcgcgctgcgtccggacgcgcccgccgtgatcgccccggacctgacc
ctgtcgtacgccgcactcgccgacgcctcccgtcaggtggcccgctggcttcgggcgcac
ggcgcacggccggggcatctggtcgccgtcgtgatggagaagggctgggaacaggccgtc
gcggcctacgccgtgctgttctcgggggccgcctatctgccgatcgaccccgacctgccc
gtacggcggatccggcagttgctggagcggggcgaggtgggtctggtgctcacccagtcc
cagctgaccctggactggccggacgggctgctgcggctgtgcctggaccagccgctgccc
gccgacaccgagaccccgctcccggcgcccggcagccccgacgacgtcgtgtgcacgctg
ttcacctcgggctccacgggcgagccgaagggcgtgcggatcacccatcgggcgctggtc
aactgtctgctggacaccctcgacacccaccggatcaccgaggccgaccgctgcctcgcg
gtgaccgccctccaccacgacctgtccgccttcgacctgttcggaatgctcggcgcgggc
ggcgccatggtcgtcccggccgccgccgaccgccgtgacccggcgcactgggcggaactg
atcgcccggaacggcgtcacggtgtggatctcggtcccggcgatgatggagatgctcctg
gagagcggtgcccgccccgactcgctccggctggcgttcctcggcggcgactggatccca
ctgcccgtgccgggccggctgaaggacctcgtgcccggcgtcgaggtggtctccatcggc
ggtccgaccgagaccacggtgtggagcatctggtacccgatcgccgggatcgacccggac
tggcggagcatcccgtacggcacgcccctcgccaacgtccgctaccgcgtcctcgacgac
cggctgcgggactgcccggactgggtgaccggcgagatgtacgtctccggggtctgcctg
gccgacggctactggcgcgaccccgaccgcacggaggcggccttcgtacggcacccggag
accggcgagcggatgtaccgcaccggggatctggggcggtggcggccggagggcaccctg
gagttcatgggccgggccgacttccaggtccagatccgcggccagcgcatcgaacccggc
gagatcgaggcggcgctgctcgcccaccccgacgtcacctcggccgtcgtcaccgccacg
gcccacgccgaccgtcccggccatgacggtctggtcgcctacgtcatcccgaacgaatcg
acggatgccgccgccttcgaggccgaccgccgcaccgggatcacactgctcgacccgctg
gcccgcgccgagttcaagctggcccgccacggactgcgccgggagcccggacggcagcgc
ctcccgctcccccgggtgcccgccgagccgtcccggcggcgcagcgaccgggcgttcctg
cccgagccggtcaccctccccgaactctccgcctgtctgggcctgttggagcaggacgag
gtggacggtctggccaagtgccgctatccgtctgcgggaggtctgtatcccgtccaggcg
tatgtgcaggtgaagtccgtggcgggtcttgcgccgggcgcgtactacgtcgaccccggc
cagaacgccctggtgccgctggccgagggcacgcgggtcggcgccgaggtgcacgcgagg
cacaaccgggcgctcgtggacgcggcgggtttcaccctgttcctggtggcggacctggac
gccatcgagccgatgtacggcacgctcgcccgcgacctgtgcctgctggaggccgggtac
atggggcagctgctgatggactgggcggcggggacggacgtaggactgtgcccgatcggg
gagctcgacttcgagccgctgaagccggagttcgcgctgggcgagcggcatgtcctggcg
cacgcgctggtcggcggccgggtggaccgcacggccgccgacccggcagccgcctccctc
ccggaccggctgcggggctggctgcgcgaacggctgcccgcgcacatggtccccgagcac
gtcctgctcctggacagctggccgctcagcgccaacggcaaggtcgaccgccgccgcctg
cccgcgccacggcacaccggcccggcgaacggctacgtcgccccgcgcaccgccaccgaa
cagcagctcgccaccctgtggtgcgaggtcctggacgtcccccgggtggggattcaggac
aacttcttcgacctcggcggacactcactggccgcgacccggctgatcgccaggatccgg
gaccgcttcgagatctccatcggcctgcgtgaggtgttcaccacccgcacggtcgccgac
ctggcgagcgcggtggaccggcgccgggagaggtag

DBGET integrated database retrieval system