KEGG   Streptomyces davawensis: BN159_5931Help
Entry
BN159_5931        CDS       T02518                                 

Definition
(GenBank) neuramidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
sdv  Streptomyces davawensis
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sdv00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BN159_5931
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BN159_5931
Enzymes [BR:sdv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     BN159_5931
Bacterial toxins [BR:sdv02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   BN159_5931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6655937..6656620
Genome map
AA seq 227 aa AA seqDB search
MKKADWRWYATGPGHAVALTRGDHAGRLVVPANHSSAPASESPDSGQEPKYYGAHAIYSD
DGGRSWHLGFVEDSYEGVRNANESTAAQLPDGRLYFNARNQKGSSPGNRLDAYSSDGGAS
LEGRGYVEQASLNDVPLVEGSVLQVGGEGGELLFSGPSVPDDRAAMALWSSADEGRTFRK
ALTLSTRKAGYSDLVQIDGEGVGVLYETGTRTAYETIEFRRVPLGSL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaggcggactggcgctggtacgccacagggccggggcatgccgtcgcgctgact
cggggcgaccatgcggggcggctcgtcgtgccggccaatcactcctccgcgccggcatcg
gaatcgccggacagcgggcaggagcccaagtactacggggcgcatgcgatctacagcgat
gacggggggcggtcctggcaccttgggttcgtcgaggactcctatgagggggtccgcaac
gccaatgagtcgaccgctgcccaactgcccgacgggcggctgtatttcaacgcccggaat
cagaagggttccagtccggggaatcgcctcgacgcctattccagtgatgggggcgcgagt
ctggaaggtcggggctatgtggagcaggcctcgttgaacgacgttccgctggttgagggc
agtgtgttgcaagtgggcggggagggtggggagttgttgttctccgggccttccgtgcct
gatgaccgtgccgccatggccttgtggagcagtgcggatgaggggcggaccttccgtaag
gcgctgaccttgtccactcgtaaggccgggtactccgacctcgtgcagatcgatggcgag
ggggtgggggtcctgtatgagaccggcacccggacagcgtacgagacgatcgagttccgg
cgcgtgcccctggggtccctgtga

DBGET integrated database retrieval system