KEGG   Streptomyces davaonensis: BN159_6200Help
Entry
BN159_6200        CDS       T02518                                 

Gene name
amy
Definition
(GenBank) Alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
sdv  Streptomyces davaonensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BN159_6200 (amy)
Enzymes [BR:sdv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BN159_6200 (amy)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6963859..6965235
Genome map
AA seq 458 aa AA seqDB search
MIRRWSVAATALTATAAGVLTPTAAYASPPGTKDVTAVMFEWNFASVAKECTNTLGPAGY
GYVQVSPPAEHIQGAQWWTSYQPVSYKIAGRLGDRTAFQNMVNTCHAAGVKVVVDTVVNH
MSAGSGTGTGGSSYSKYNYPGLYSSYDFDNCTSQITNYQDRWNVQNCELVGLADLDTGES
YVRGAIAGYMNDLLSLGVDGFRIDAAKHIPAADLANIKSRLTNTSVYWKQEVIYGSGEAV
QPTEYTGNGDVQEFRYAYDLKRVFNNENLAYLKNYGEGWGYMSSSVSGVFVDNHDTERNG
STLNYKDGANYTLANVFMLAYPYGAPDINSAYEWSDTDAGPPNGGTVNACWQDGWKCQHK
WPEIQRMVAFRNATRGEAVTNWWDNGADAIAFGRGSKGYVAINHESGSLTRTYQTSLPAG
TYCNVQNNTTVSVNSSGQFSATLGSNTALAIYAGKSSC
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
gtgatacgcagatggtccgtcgccgcgacggcgctcaccgccacggcggccggcgtgctg
acccccacagccgcgtacgcctcgccgcccggcaccaaggacgtcaccgcggtgatgttc
gagtggaacttcgcctccgtcgccaaggagtgcaccaacaccctcggccccgccggttac
ggctacgtccaggtctcgccgcccgccgagcacatccagggcgcgcagtggtggacgtcg
taccagccggtcagttacaagatcgccgggcggctcggcgaccgtaccgccttccagaac
atggtcaacacctgtcacgcggccggggtgaaggtcgtcgtcgacaccgtcgtcaaccac
atgtccgcgggcagcggcaccggcaccggcggatcgtcgtacagcaagtacaactacccc
ggcctgtactcctcctacgacttcgacaactgcaccagccagatcaccaactaccaggac
cgctggaacgtccagaactgcgagctcgtcgggctcgccgacctcgacaccggggagtcc
tacgtccgcggcgccatcgccgggtacatgaacgacctgctctcgctcggcgtcgacggc
ttccggatcgacgcggccaagcacatccccgccgccgacctggccaacatcaagtcgcgc
ctcaccaacacctccgtgtactggaagcaggaggtcatctacggcagcggcgaggccgtc
cagcccaccgagtacacgggcaacggcgacgtccaggagttccgctacgcctacgacctc
aagcgcgtcttcaacaacgagaacctcgcctacctgaagaactacggcgagggctggggc
tacatgagcagctcggtctccggtgtcttcgtcgacaaccacgacaccgagcgcaacggc
tccacgctcaactacaaggacggggcgaactacaccctcgccaacgtcttcatgctcgcc
tacccctacggcgccccggacatcaactccgcctacgagtggtccgacaccgacgcgggc
ccgcccaacggcggcacggtcaacgcctgctggcaggacggctggaagtgccagcacaag
tggcccgagatccagcgcatggtcgccttccgcaacgccacccgcggcgaggcggtgacc
aactggtgggacaacggcgccgacgccatcgccttcggccggggcagcaagggctacgtc
gccatcaaccacgagtcgggcagcctgacccgcacctaccagacctccctgcccgcgggg
acgtactgcaacgtgcagaacaacacgaccgtgtccgtgaactccagtggtcagttctcg
gccactctcggctccaacacggcgctggcgatctacgcgggcaagtccagctgctga

DBGET integrated database retrieval system