KEGG   Salmonella enterica subsp. enterica serovar Typhimurium ST4/74: STM474_1920Help
Entry
STM474_1920       CDS       T01760                                 

Gene name
pykA
Definition
pyruvate kinase
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
seb  Salmonella enterica subsp. enterica serovar Typhimurium ST4/74
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:seb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STM474_1920 (pykA)
   01230 Biosynthesis of amino acids
    STM474_1920 (pykA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STM474_1920 (pykA)
   00620 Pyruvate metabolism
    STM474_1920 (pykA)
  Nucleotide metabolism
   00230 Purine metabolism
    STM474_1920 (pykA)
Enzymes [BR:seb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     STM474_1920 (pykA)
Exosome [BR:seb04147]
 Exosomal proteins
  Proteins found in most exosomes
   STM474_1920 (pykA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LinkDB All DBs
Position
1940045..1941487
Genome map
AA seq 480 aa AA seqDB search
MSRRLRRTKIVTTLGPATDRDNNLEKVIAAGANVVRMNFSHGSPEDHKMRADKVREIAAK
LGRHVAILGDLQGPKIRVSTFKEGKVFLNIGDKFLLDANLGKGEGDKEKVGIDYKGLPAD
VVPGDILLLDDGRVQLKVLEVQGMKVFTEVTVGGPLSNNKGINKLGGGLSAEALTEKDKA
DIQTAALIGVDYLAVSFPRCGEDLNYARRLARDAGCDAKIVAKVERAEAVCDQNAMDDII
LASDVVMVARGDLGVEIGDPELVGIQKALIRRARQLNRAVITATQMMESMITNPMPTRAE
VMDVANAVLDGTDAVMLSAETAAGQYPSETVAAMARVCLGAEKIPSINVSKHRLDVQFDN
VEEAIAMSAMYAANHLKGVTAIITMTESGRTALMTSRISSGLPIFAMSRHERTLNLTALY
RGVTPVHFDSAADGVVAAHEAVNLLRDKGYLVSGDLVIVTQGDVMSTVGSTNTTRILTVE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtccagaaggcttcgcagaaccaaaatcgttaccacgttaggcccggcaactgaccgc
gataacaaccttgagaaggttatcgccgcgggcgcaaacgtagtacgtatgaacttctct
cacggctcgccggaagatcataaaatgcgtgctgataaagtccgtgagattgccgccaaa
ctggggcgtcatgtggctattttaggcgacctgcaagggccaaaaattcgcgtttccact
tttaaagaaggcaaagtgttcctcaacatcggggacaaatttctgttagacgctaacctg
ggtaaaggcgaaggcgacaaagaaaaagtcggcattgattacaaagggttgccggcagac
gtcgttcctggcgatatcctgctgcttgacgatggtcgagtgcagttgaaagtgcttgaa
gtccagggcatgaaagtctttaccgaggtcaccgtcggcggcccgctgtctaacaataaa
ggcattaacaagctcggcggcgggctttctgctgaagcgctgaccgaaaaagacaaagcc
gatattcaaaccgctgcgctgataggtgttgactatctggccgtctccttcccgcgctgc
ggcgaagatctgaactatgcacgccgcctggcgcgcgacgccggctgcgacgcgaaaatt
gtggctaaggtcgaacgcgccgaagcggtatgcgaccaaaacgccatggacgatatcatt
ctggcctctgacgttgtgatggtcgcacgtggcgatctgggcgttgaaatcggcgatccg
gagctggttggtatccagaaagcgctgattcgccgtgcgcgtcagctaaaccgcgcagtc
atcaccgcaacgcaaatgatggagtcgatgatcaccaacccgatgccgacccgtgcggaa
gtgatggacgtggcgaacgccgtcctggatggcacggatgcggttatgctgtctgccgaa
accgcagccggtcagtatccttctgaaaccgttgccgcaatggcgcgcgtctgcctgggc
gcagaaaaaatccccagcatcaatgtgtctaaacaccgtctcgacgtgcagttcgacaac
gttgaagaagccattgccatgtctgcgatgtatgcggcaaaccatctgaaaggcgttacc
gcgatcatcaccatgacggaatccggtcgtaccgcgctaatgacttcccgtatcagctcc
ggcctgccgattttcgccatgtcgcgccatgaacgcacgctgaacctgaccgcgctctat
cgcggagtaacgccggtgcattttgatagcgcggctgatggcgttgtcgcggcacatgaa
gctgttaatctgctgcgcgataaagggtatctggtttccggcgacctggttatcgtgacc
cagggcgatgtcatgagcaccgtcggttcaaccaataccacgcgtattttgaccgttgag
taa

DBGET integrated database retrieval system