KEGG   Salmonella enterica subsp. enterica serovar Choleraesuis: SCH_2287Help
Entry
SCH_2287          CDS       T00240                                 

Gene name
glpA
Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase (anaerobic), large subunit
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sec  Salmonella enterica subsp. enterica serovar Choleraesuis
Pathway
sec00564  Glycerophospholipid metabolism
sec01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sec00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SCH_2287 (glpA)
Enzymes [BR:sec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SCH_2287 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 DAO_C 3HCDH_N Thi4 HI0933_like NAD_binding_8 Pyr_redox_3 Lycopene_cycl GIDA Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AAX66193
UniProt: Q57M69
LinkDB All DBs
Position
2404517..2406145
Genome map
AA seq 542 aa AA seqDB search
MKTRDSQASDVIIIGGGATGAGIARDCALRGLRVILVERHDIATGATGRNHGLLHSGARY
AVTDAESARECISENQILKRIARHCVEPTDGLFITLPEDDLAFQATFIRACEAAGIRAEA
IDPQQARIIEPSVNPALIGAVKVPDGTVDSFRLTAANMLDAREHGAIVLTAHEVTGLIRE
GATVCGVHVRNHLTGETQTLHAPVVVNAAGIWGQRIAEYADLSIRMFPAKGSLLIMDHRI
NQHVINRCRKPSDADILVPGDTISLIGTTSTHIDYNEIDNNRVTADEVDILLREGEKLAP
VMAKTRILRAYSGVRPLVASDDDPSGRNVSRGIVLFDHAERDGLEGFITITGGKLMTYRL
MAEWATDAVCRKLGNTRPCITADTPLPGSKESTEHTLKRIISLPAPLRGSAVYRHGDRTP
GWLSEGRQHRSLVCECEAVTAGEVQYAVENLTVNSLLDLRRRTRVGMGTCQGELCACRAA
GLLQRFNVTTAAQSITQLSEFLNERWKGVQPVAWGDALRESEFTRWVYQGLCGLEKEHQD
EI
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcgcgactcgcaagcaagtgacgtgattatcattggcggtggagcaacaggc
gcagggatcgcccgcgactgcgcgctgcgcggtttacgtgtcattctggtggaacggcat
gatatagcgaccggcgcgaccgggcgtaaccacggactgctgcacagcggcgctcgttat
gcggttaccgacgcggaatccgcgcgcgagtgcattagtgaaaaccagattttaaaacgg
atcgcccgccattgcgtcgaaccgacggatggtctgtttattacgttgccggaagatgat
cttgcgtttcaggccacctttattcgcgcctgtgaagcggcgggcattcgcgctgaagcc
atcgatccgcagcaggctcgcatcatcgaaccttccgttaaccctgcgctcatcggtgcg
gtaaaagtgccggatggcaccgtggactctttccgccttaccgccgccaatatgctggat
gccagagaacatggcgcaatcgtgttaacggcgcatgaagtgaccgggctcattcgtgaa
ggcgcaacggtctgcggcgtccatgtgcgcaaccatctcactggcgaaacccagacgctt
cacgcgccggtggtggtcaatgcggcaggtatctgggggcaacggatcgccgaatacgcc
gacctgagtattcgcatgttcccggcgaaaggctcgctgttgatcatggaccatcggatc
aaccagcatgtcattaaccgctgccggaaaccatcggatgccgacattctggtacctggc
gatacgatttcactgatcggcaccacctctacccatattgattacaatgagatagacaac
aaccgcgtcaccgcagatgaagtcgatatcctgctgcgtgaaggggaaaaactggcccct
gtcatggcgaagacgcgtattctgcgcgcgtattccggcgtccgcccgctggtggccagc
gatgacgatcccagtggtcgtaacgtcagccgcggtattgtgttgttcgaccacgccgag
cgcgacgggcttgaaggcttcattaccattaccggcgggaagctaatgacttaccgcctg
atggcggaatgggcgaccgatgccgtgtgccgcaagttgggcaatactcgcccctgcatc
acggcggatacgccgttgcctggctcaaaagagtctacagaacatacgctgaaacgcatt
atctcgcttcccgcgccgctacgcggatcggcggtttatcggcatggcgatcgcacgccg
gggtggctgagtgaaggccgccaacaccgtagcctggtctgtgaatgcgaggccgtcacg
gcgggggaagtgcagtatgccgtcgaaaacttaaccgtgaatagcctgctggatctgcgc
cgtcgcacccgcgtagggatgggcacttgccagggcgagctatgcgcctgccgcgcagcc
gggctattgcagcgttttaatgtgacgaccgcggcgcaatctattacgcaactctctgaa
tttctgaatgagcgctggaaaggcgtacaacctgtcgcctggggagacgcgctgcgcgaa
agcgaattcacgcgctgggtttatcagggattatgcggtctggagaaggagcaccaggat
gaaatttga

DBGET integrated database retrieval system