KEGG   Salmonella enterica subsp. enterica serovar Bareilly: SEEB0189_012280Help
Entry
SEEB0189_012280   CDS       T02739                                 

Definition
(GenBank) glutathionine S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
seeb  Salmonella enterica subsp. enterica serovar Bareilly
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:seeb00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SEEB0189_012280
Enzymes [BR:seeb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SEEB0189_012280
Transporters [BR:seeb02000]
 Other Transporters
  Pores ion channels [TC:1]
   SEEB0189_012280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2503186..2503791
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLASHITLREIGKDFTLDGVDLAKKRLENGDDYLAVNPKGQVPALLLDDG
TLLTEGVAIMQYLADSVPDRQLLAPVSSLARYHTLEWLNYIATELHKGFTPLFRPDTPET
LKPAVRAGLEKKLQYVDESLSDDQWICGQRFTIADAYLFTVLRWAYGVKLNMDGLTHIES
YMQRVAKRPTVAAALKAEGLN
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctacaaaccgggtgcctgctctcttgcttcccatattaccctgcgcgaa
attggcaaagactttacgcttgatggcgtcgatctcgcaaaaaaacgcctggaaaacggt
gatgattacctggcagtcaaccctaaaggacaggttccggctctgctgctggatgacggc
acactgttgactgaaggcgtcgccattatgcagtacctcgccgacagcgttcccgaccgc
cagcttctggcgccggtaagtagtcttgctcgctatcatacgctggaatggctcaactat
attgcaacggaactgcataaaggctttaccccgctgttccgccctgacacgccggaaaca
cttaaacccgccgttcgcgccggtctggaaaagaaattgcagtatgtggatgagtcgctt
tcagacgaccagtggatttgcggccagcgttttaccatcgcagacgcttatctgtttacc
gtattgcgttgggcctatggcgtaaaactgaatatggacgggttaacgcatattgaaagt
tatatgcagcgtgtcgcaaaaagaccgaccgttgcggcagcgcttaaagcggaaggactg
aattaa

DBGET integrated database retrieval system