KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67: SPUCDC_2190Help
Entry
SPUCDC_2190       CDS       T02824                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase 1
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sega  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sega00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPUCDC_2190 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SPUCDC_2190 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPUCDC_2190 (gpmA)
Enzymes [BR:sega01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SPUCDC_2190 (gpmA)
Membrane trafficking [BR:sega04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SPUCDC_2190 (gpmA)
Exosome [BR:sega04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SPUCDC_2190 (gpmA)
  Exosomal proteins of melanoma cells
   SPUCDC_2190 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2201051..2201803
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNDTILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEDEILELNIPTGVPLVYEFDENFKPLKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtacgtcacggtgaaagtcaatggaacaaagagaac
cgtttcaccggctggtatgatgttgacctgtctgaaaaaggcgtaagcgaagcaaaagca
gcgggtaaactgctaaaagaagaaggtttcagctttgattttgcctacacttccgtactg
aaacgcgctatccatacgctgtggaacgtactggatgaactggatcaagcgtggctgccg
gtggaaaaatcctggaaactcaatgaacgtcactatggcgcgttgcaggggctgaacaaa
gcggaaacggcagaaaaatatggtgacgagcaggttaaacagtggcgccgcggttttgcc
gtgacgccgccggaactgaccaaagatgatgagcgttatccgggtcacgatccacgttat
gccaaactgagcgagaaagagctgccgttgaccgaaagtctggcgctgaccatcgaccgc
gttattccttactggaacgacaccatcctgccgcgtatgaagagcggtgagcgcgtgatc
atcgccgctcacggtaactcattgcgtgcgctggtgaaatacctggataacatgagtgaa
gatgagatccttgagttaaacatcccgaccggcgtgccgctggtgtatgagttcgacgaa
aacttcaagccgctcaaacattactatctgggcaacgctgacgaaatcgccgcgaaagcg
gctgccgtggcgaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system