KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67: SPUCDC_3426Help
Entry
SPUCDC_3426       CDS       T02824                                 

Gene name
tufA
Definition
(GenBank) elongation factor tu
  KO
K02358  
elongation factor Tu
Organism
sega  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67
Brite
Translation factors [BR:sega03012]
 Eukaryotic Type
  Elongation factors
   SPUCDC_3426 (tufA)
 Prokaryotic Type
   SPUCDC_3426 (tufA)
Mitochondrial biogenesis [BR:sega03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SPUCDC_3426 (tufA)
Exosome [BR:sega04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SPUCDC_3426 (tufA)
  Exosomal proteins of breast cancer cells
   SPUCDC_3426 (tufA)
  Exosomal proteins of colorectal cancer cells
   SPUCDC_3426 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3442800..3443984)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GDAEWEAKIIELAGFLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKETQKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccatggtaaaacaacgctgaccgctgccattactaccgtactggctaaaacctac
ggcggtgccgcccgcgcattcgaccagatcgataacgcgccggaagaaaaagcgcgtggt
atcaccatcaacacttctcacgttgaatacgataccccgacccgccactacgcacacgta
gactgcccggggcacgccgactatgttaaaaacatgatcaccggtgctgctcagatggac
ggcgcgattctggttgttgctgcgactgacggcccgatgccgcagacccgtgagcacatc
ctgctgggtcgtcaggtaggcgttccgtacatcatcgtgttcctgaacaaatgcgacatg
gttgatgacgaagagctgctggaactggttgaaatggaagttcgtgaacttctgtctcag
tacgacttcccgggcgacgacactccgatcgttcgtggttctgctctgaaagcgctggaa
ggcgacgcagagtgggaagcgaaaatcatcgaactggctggcttcctggattcttacatc
ccggaaccagagcgtgcgattgacaagccgttcctgctgccgatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgtagaacgcggtatcatcaaagtgggc
gaagaagttgaaatcgttggtatcaaagagactcagaagtctacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgccggtgagaacgtaggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggtactggctaagccgggcaccatcaag
ccgcacaccaagttcgaatctgaagtgtacattctgtccaaagatgaaggcggccgtcac
actccgttcttcaaaggctaccgtccgcagttctacttccgtactactgacgtgactggc
accatcgaactgccggaaggcgtagagatggtaatgccgggcgacaacatcaaaatggtt
gttaccctgatccacccgatcgcaatggacgacggtctgcgtttcgcaatccgtgaaggc
ggccgtaccgttggcgcgggcgttgttgctaaagttctcggctaa

DBGET integrated database retrieval system