KEGG   Salmonella enterica subsp. enterica serovar Typhimurium UK-1: STMUK_2780Help
Entry
STMUK_2780        CDS       T01743                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
sej  Salmonella enterica subsp. enterica serovar Typhimurium UK-1
Pathway
sej00250  Alanine, aspartate and glutamate metabolism
sej00280  Valine, leucine and isoleucine degradation
sej00410  beta-Alanine metabolism
sej00640  Propanoate metabolism
sej00650  Butanoate metabolism
sej01100  Metabolic pathways
sej01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sej00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    STMUK_2780 (gabT)
   00650 Butanoate metabolism
    STMUK_2780 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    STMUK_2780 (gabT)
   00280 Valine, leucine and isoleucine degradation
    STMUK_2780 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    STMUK_2780 (gabT)
Enzymes [BR:sej01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     STMUK_2780 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     STMUK_2780 (gabT)
Amino acid related enzymes [BR:sej01007]
 Aminotransferase (transaminase)
  Class III
   STMUK_2780 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEF08651
LinkDB All DBs
Position
2910085..2911368
Genome map
AA seq 427 aa AA seqDB search
MNTNNALMQRRHNAVPRGVGQIHPIFAERAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
GIVSAVEAQLKKLSHTCFQVLAYEPYLALCERMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGAIAFSGAYHGRTHYTLSLTGKVHPYSAGMGLMPGHVYRALYPCPLHNISD
DDAIASIERIFKNDAAPEDIAAIIIEPVQGEGGFYAASPAFMQRLRALCDQHGIMLIADE
VQSGAGRTGTLFAMEQMGVAADITTFAKSIAGGFPLAGVTGRADVMDAIAPGGLGGTYAG
NPIACAAALAVLDIFEQENLLQKANTLGKTLRDGLMEIAETHREIGDVRGLGAMIAIELF
ENGDPGKPNAALTADIVTRAREKGLILLSCGPYYNILRILVPLTIEASQIRQGLEIIAQC
FDEAKQA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaataccaataacgctttaatgcagcgccgtcataacgccgttcctcgcggcgtgggg
cagattcacccgattttcgccgagcgggcggaaaattgtcgggtgtgggatgtcgaaggc
cgtgagtatctcgatttcgcgggcggcattgccgtcctgaacaccggtcatttacatccg
ggcattgtttcagcggtcgaagcgcagttgaagaaattgtcccatacctgttttcaggtg
ctggcctatgaaccgtatctggcgttgtgcgaacgcatgaaccagaaggtaccgggcgat
ttcgccaaaaaaacgttgctggtcacgaccggttcagaagcggttgaaaacgcggtgaaa
atcgcccgcgcggcgacaaaacgcagcggcgctatcgcgtttagcggcgcttaccacggt
cgtacccactacacgctctctctgaccgggaaagtacacccgtactctgctggtatggga
ttgatgccaggccatgtctaccgcgcgctttatccttgcccgctacacaacatcagcgac
gacgacgcgatcgccagcattgaacgcatctttaaaaatgatgccgcgccggaagatatc
gccgccattattattgagccggtacagggcgaaggcggattttacgccgcctctcccgcg
tttatgcagcgactgcgcgcgctatgcgaccaacacggcattatgttgattgccgacgaa
gtgcaaagcggcgcgggccggaccggtacgctgttcgccatggaacagatgggcgttgcg
gcagatattaccacgtttgcgaaatcgatcgccggcggctttccgctggcaggcgttacc
ggccgggcagacgtgatggacgctatcgcgccgggcgggctgggcggcacctatgccgga
aacccgattgcctgcgccgccgcgctggcggtactggacattttcgagcaggaaaatcta
ctgcaaaaggcgaatacgcttggcaaaacgctgcgcgatggcctgatggagatagcggaa
acgcaccgtgagattggcgacgtgcgcggactgggcgccatgatcgccattgagttgttc
gaaaatggcgaccccggcaaaccgaacgcggctctgaccgccgacattgtgacccgcgcc
cgcgagaaagggttaattctgctctcctgcggtccttactacaacatcttgcgcatcctc
gttccactcactattgaggcctcgcagattcggcaaggcctggagattatcgcccagtgc
tttgatgaggcgaaacaagcgtaa

DBGET integrated database retrieval system