KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601: SSPA3282Help
Entry
SSPA3282          CDS       T00756                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
sek  Salmonella enterica subsp. enterica serovar Paratyphi A AKU12601
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sek00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SSPA3282
Enzymes [BR:sek01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SSPA3282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3634114..3636141
Genome map
AA seq 675 aa AA seqDB search
MKFAAFALTLIPGIAIASSWTSPGFPTFSTQETGRFTSHAALTKGTRALTLHIDQQCWQP
SSAIKLNQMLSLKPCEGAPPQWRLFKDGDYTITVDTRSGTPTLLLSIKTEPERTAQLTYQ
CPVWDGSPLTLDVRQTFPEGTVVRDYYSGQTDTIQNGKITLRPADSHGLLLLERAETHAS
APFNWRNATVYFVLTDRFRNGDPTNDHSYGRHKDGMQEIGTFHGGDLRGLTSQLDYLQQL
GVNALWISAPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTTLDANMGSEADLRALVDGAH
QRGIRILFDVVMNHAGYATLADMQEYQFGALYLSGAERQKILGDRWTNWRPATGQSWHSF
NDYINFSDSAAWEKWWGKKWIRTDIGDYDSPGFDDLTLSLAFLPDIKTESTTPSGLPAFY
ANKPGTKAKFIEGYTPRDYLTHWLSQWVHDYGIDGFRVDTAKNVELPAWQQLKTQASAAL
HEWKQANPDKALDDSPFWMTGEAWGHGVMKSDYYRYGFDAMINFDYQEQAAKAVDCLAEM
GPVWQQMADKMQDFNVLSYLSSHDTRLFREGGDKAAELLLLSPGAVQIFYGDESARPFGP
TGSDPLQGTRSDMNWQDVSGKSAAAVAHWQHISQFRARHPAIGAGQQTTLTLKHGYGFVR
QYGDDTVMVVWAGRR
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgccgccttcgctctgacgctgatacccggtatcgcgatcgcctcatcatgg
acctcacccggttttccgacgttctcgacgcaggaaaccgggcgctttaccagccatgct
gcattaacaaaaggtacacgcgcgttaacgctccatattgaccagcagtgctggcagccc
tccagcgccataaaactcaaccaaatgttgtcgttaaaaccctgcgaaggcgcgccgccg
caatggcgcctgtttaaagatggcgactatacgataacggtagatacccgctccggtacg
ccgaccctgttgttatcgataaaaactgaacctgaacgcaccgcgcagctcacctaccag
tgtcccgtctgggatggttcgccgctcacgctggatgttcgccaaacctttccggaaggg
acggtagtgcgcgattattacagtggtcaaaccgataccatccaaaacggaaaaatcacg
ctgcgacctgccgacagccacgggcttttattgctggaacgcgcggaaacccatgcgtca
gcgccttttaactggcgcaacgccaccgtttattttgtgcttacggatcgctttcgcaat
ggcgatccaaccaacgaccacagctatggtcgccataaggatggtatgcaagagattggc
actttccacggcggcgatttacgcgggttgacgagtcaactggactatctacagcaatta
ggcgtgaacgccttgtggataagcgcgccgtttgaacagatccacggctgggtcggcggc
ggaacaaaaggcgattttcctcattacgcctatcacggctattacactcaggactggacg
acgctggatgccaatatgggcagcgaagccgatctccgcgcactggtcgacggagcgcac
cagcgcggcatccgtattttatttgacgtagtaatgaatcatgccggttacgccacgctg
gcggatatgcaggagtatcagtttggcgcgctctatttatccggcgcggaacggcaaaaa
attctcggcgatcgctggacaaactggcgaccggccaccggacaaagctggcacagcttt
aacgactacatcaacttcagcgacagcgccgcctgggaaaaatggtgggggaaaaagtgg
attcgtaccgatattggcgactacgacagtccgggatttgacgatttaaccctgtcgctg
gccttcctgccggatataaaaacggaatctaccacgccttccggcctacccgcgttctat
gccaacaaacccggtactaaagcaaagttcattgaaggctatacgccacgggattatctg
actcactggttaagccagtgggtgcatgattacggcattgacgggttccgggtcgatact
gccaaaaatgttgagcttcctgcctggcaacagctaaaaacccaggccagcgcggcgtta
catgaatggaagcaggccaatccggacaaagcgctggatgatagcccgttctggatgact
ggcgaagcgtggggccacggcgtcatgaaaagtgattattatcgctatggtttcgacgcg
atgatcaattttgattatcaggagcaggcggcgaaagcggtcgattgcctggcggaaatg
gggccagtctggcagcagatggcggataaaatgcaggatttcaacgtattaagttatctc
tcctcgcatgatacgcgccttttccgtgagggcggtgataaggcggcggaactgctgctg
ctttcaccgggcgcggtgcagatcttttacggcgatgaatccgctcgtcccttcggcccc
accggctccgacccgctgcaaggcacccgttcagatatgaactggcaggacgtgagcgga
aagtcagccgcagccgtcgcgcactggcagcatattagccagttccgcgccagacatccc
gccatcggcgcaggccaacaaaccacgttgacgctaaaacatgggtacggttttgtacgc
cagtacggcgacgatacggtgatggtcgtctgggcgggccgccgctaa

DBGET integrated database retrieval system