KEGG   Selenomonas sp. oral taxon 478: ADJ74_04700Help
Entry
ADJ74_04700       CDS       T04017                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
sele  Selenomonas sp. oral taxon 478
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sele00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    ADJ74_04700
Enzymes [BR:sele01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     ADJ74_04700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(1011751..1013046)
Genome map
AA seq 431 aa AA seqDB search
MKNVYTCFCTDIIHAGHKNLLRAAAELGRVTVGVLSDAEMVRYNRFPTKTLEERMTMLSE
LPEVAEVIVQDHIMYDEVLDRLRPDYVVHGSNWAQGPESAIRKNVLAALARYGGKLIEPS
YTYNDEVRKIDWQMREQLAMPEARRGRLRRLLDIVPIVKTIEVHNGLTGLIAEKTIVEND
GGLDQFDAMWVSSLCDSTSRGKPDIELVDLSDRIQTINEVMDVTTKPIILDMDTGGTAEH
FAYNVRTLERIGVSAVIVEDKTGAKRNSLFGTEVAQTQDTIENFSEKIAAGKSAQRTEEF
MIIARIESLILEKGQEDALARAEAYVAAGADAIMIHSRAKSPDEVIAFCDAFHASHPDVP
IVAVPSSYNTITEAELAAHGVRIVIYANQLTRAAFPSMENAARSILVHHRAHEIDKELLP
IKDIIRLIEVV
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacgtttatacctgcttctgcacggacatcatccacgcggggcacaagaacctc
ctgcgcgcggcggcagagctcggccgcgtcactgtcggcgtcctctccgacgcggagatg
gtgcgctacaaccgcttcccgacgaagacactcgaggagcgcatgacaatgctcagcgag
ctgcccgaggtcgcggaggtcatcgtacaggatcacatcatgtacgacgaggtactggac
cgtctgcgccccgactacgtcgtccacgggagcaactgggcgcagggtcctgagtccgcc
atccgcaagaacgtcctcgcggcgctcgcgcgctacggcggaaaactgatcgaaccatcc
tatacctataatgacgaggtgcgcaagatcgactggcagatgcgcgagcagctcgctatg
cccgaggcgcgccgcggccgtctgcgccgtctcctcgatattgtccccatcgtcaagacc
atcgaggtgcacaacggcctcacgggactgatcgcggagaaaaccatcgtcgagaatgac
ggcggcctcgaccagttcgacgccatgtgggtctccagtctctgtgactcgacctcacgc
ggcaagcccgacatcgagctcgtcgacctctccgaccggatccagaccatcaacgaggtc
atggacgtcacgacgaagcccatcatcctcgacatggacacgggcggaacggcagaacac
ttcgcctacaacgtccgcacccttgagcgcatcggcgtttccgccgtcatcgtcgaggac
aaaacgggcgcaaaacgcaactccctctttggcacggaggtcgcgcagacgcaggacacg
atcgaaaatttctccgaaaagattgcggcgggcaaatcggcacagcgcacggaggagttc
atgatcatcgcgcgcatcgagagcctgatcctcgaaaaggggcaggaggatgccctcgca
cgcgccgaagcgtacgtcgcggcgggtgcagacgccatcatgatccactcgcgcgccaaa
tcgcccgatgaggtcatcgcgttctgcgacgccttccacgcgagccacccggacgtcccc
atcgtcgccgtcccctcctcctacaacacgatcacggaggcggagctcgcggcacatggc
gtccgcatcgtcatctacgccaaccagctcacgcgcgcggcattcccctctatggagaat
gcggcacgctccatcctcgtccatcaccgcgcccacgagatcgacaaggagctcctgccg
atcaaggacatcatccgactgatcgaggtcgtctga

DBGET integrated database retrieval system