KEGG   Selenomonas sp. oral taxon 136: AXE86_05255Help
Entry
AXE86_05255       CDS       T04745                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
selo  Selenomonas sp. oral taxon 136
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:selo00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    AXE86_05255
Enzymes [BR:selo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     AXE86_05255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1082880..1084175
Genome map
AA seq 431 aa AA seqDB search
MKNVYTCFCTDIIHAGHKNLLRAAAELGRVTVGVLSDAEMVRYNRFPTKTLEERMAMLSE
LSEVAEVIVQDHIMYDEVLDRLRPDYVVHGSNWAQGPESAIRKNVLAALARYGGKLIEPS
YTYNDEVRKIDWQMRELLAMPEARRGRLRRLLDIVPIIKTIEVHNGLTGLIAEKTIVEND
GGLDQFDAMWVSSLCDSTSRGKPDIELVDLSDRIQTINEVMDVTTKPIILDMDTGGTAEH
FAYNVRTLERIGVSAVIVEDKTGAKRNSLFGTEVAQTQDTIENFSEKIAAGKSAQRTEEF
MIIARIESLILEKGQEDALARAEAYVAAGADAIMIHSRAKSPDEVIAFCDAFHASHPDVP
IVAVPSSYNTITEAELAAHGVRIVIYANQLTRAAFPSMENAARSILVHHRAHEIDKELLP
IKDIIRLIEVV
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacgtttatacctgcttctgcacggacatcatccacgcaggacacaagaacctc
ctgcgcgcggcggcggagctcggccgggtcactgtcggtgtcctctccgacgcggagatg
gtacgctacaaccgctttccgacgaagacactcgaagagcgcatggcgatgctcagcgag
ctgtccgaggtcgcggaggtcatcgtacaggatcacatcatgtacgacgaggtactggat
cgtctgcgccccgactacgtcgtccacggaagcaactgggcgcagggccctgagtccgcc
atccgcaagaacgtcctcgcggcgctcgcgcgctacggcggaaaactgatcgaaccatcc
tatacctataatgacgaggtgcgcaagatcgactggcagatgcgtgagctgctcgctatg
cccgaggcgcgccgcggccgtctgcgccgtctcctcgacattgtccccatcatcaagacc
atcgaggtgcacaacggcctcacgggactgatcgcggagaaaaccatcgtcgagaatgac
ggcggcctcgaccagttcgacgccatgtgggtctccagtctctgtgactcgacctcacgc
ggcaagcccgacatcgagctcgtcgacctctccgaccgcatccagaccatcaacgaggtc
atggacgtcacgacgaagcccatcatcctcgacatggacacgggcggaacggcagagcac
ttcgcctacaacgtccgcaccctcgagcgtatcggcgtctccgccgtcatcgtcgaggac
aagacgggcgcaaagcgcaactccctctttggcacggaggtcgcgcagacgcaggacacg
atcgaaaatttctccgaaaagattgcggcgggcaaatcggcacagcgcacggaggagttc
atgatcatcgcgcgcatcgagagcctgatcctcgaaaaggggcaggaggatgccctcgca
cgcgccgaagcgtatgtcgcggcgggtgcagacgccatcatgatccactcgcgcgccaaa
tcgcccgatgaggtcatcgcattctgcgacgccttccacgcgagccaccctgacgtcccc
atcgtcgccgtcccctcctcctacaacacgatcacggaggcagagctcgcggcacatggc
gtccgcatcgtcatctacgcaaaccagctcacccgcgcggcattcccctctatggagaat
gcggcacgctccatcctcgtccatcaccgcgcccacgagatcgacaaggagctcctgccg
atcaaggacatcatccgactgatcgaggtcgtctga

DBGET integrated database retrieval system