KEGG   Selenomonas sp. oral taxon 920: BCS37_09085Help
Entry
BCS37_09085       CDS       T04818                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
selt  Selenomonas sp. oral taxon 920
Brite
Translation factors [BR:selt03012]
 Eukaryotic Type
  Elongation factors
   BCS37_09085
 Prokaryotic Type
   BCS37_09085
Mitochondrial biogenesis [BR:selt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BCS37_09085
Exosome [BR:selt04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BCS37_09085
  Exosomal proteins of breast cancer cells
   BCS37_09085
  Exosomal proteins of colorectal cancer cells
   BCS37_09085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1866309..1867496)
Genome map
AA seq 395 aa AA seqDB search
MAKEKFNRSKPHVNIGTIGHVDHGKTTLTAAITKVLSEKGYAKFEDYADIDKAPEERERG
ITINTAHVEYETDNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKVDQVDDPELLELVEMEVRELLSQYEFPGDDIPVIAGSALKALE
GDEAMKAKILELMDAVDSYIPTPTRDTDKPFLMPVEDVFTITGRGTVATGRVERGELKLN
DTVEIVGLQDEARSTVVTGIEMFRKLLDSAVAGDNIGALLRGVDRKDIERGQVLAKPGSI
NPHTKFKAQVYVLTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVRLPEGTEMVMPGDNVEM
EVELITPIAIEQGLRFAIREGGHTVGAGRVTAIEG
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggaaaagtttaaccgcagcaagccccatgtcaacatcggcacgatcggtcac
gttgaccacggcaagacgacgctgacggctgcgatcacgaaggttctctccgagaagggc
tatgcgaagttcgaggactatgcggacatcgacaaggctccggaggagcgcgagcgcggc
attacgatcaacacggcgcacgttgagtatgagacggacaaccgccactatgcacacgtt
gactgcccgggccacgcggactatgtcaagaacatgatcacgggcgctgcacagatggac
ggcgcgattctcgttgtctccgctgcagacggcccgatgccccagacgcgtgagcacatt
ctgcttgctcgccaggtcggcgttccggctctcgttgtcttcctcaacaaggttgaccag
gttgacgatcccgagctcctcgagctcgtcgagatggaagttcgtgagctgctctcgcag
tacgagttccccggcgacgacatccctgtcattgcaggctccgcactcaaggcgcttgag
ggtgacgaggcgatgaaggcgaagatcctcgagctcatggatgcggttgattcgtacatc
ccgacgccgacgcgtgacacggataagccgttcctcatgccggttgaggacgtgttcacg
atcacgggccgcggcacggttgccacgggtcgtgtggagcgcggcgagctgaagctgaac
gatacggttgagatcgtcggccttcaggatgaggcgcgcagcacggttgtcacgggcatc
gagatgttccgcaagctgctcgacagcgcggttgcgggcgacaacatcggtgcgctgctc
cgtggcgtggatcgcaaggacatcgagcgcggtcaggttctcgcaaagccgggttccatc
aatccgcacacgaagttcaaggcacaggtctacgtcctgacgaaggaagagggcggccgc
cacactccgttcttcacgaactatcgtccccagttctacttccgtaccacggacgtgacg
ggcgttgtccgtctccccgagggcactgagatggttatgcccggcgataacgtcgagatg
gaagtcgagctcatcacgccgatcgcgatcgagcagggcctccgcttcgctatccgcgag
ggcggccacacggtcggcgcgggtcgtgttacggcaatcgagggctaa

DBGET integrated database retrieval system