KEGG   Saccharopolyspora erythraea: SACE_3418Help
Entry
SACE_3418         CDS       T00492                                 

Definition
(GenBank) aminotransferase class III
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sen  Saccharopolyspora erythraea
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SACE_3418
   00650 Butanoate metabolism
    SACE_3418
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SACE_3418
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SACE_3418
Enzymes [BR:sen01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SACE_3418
Amino acid related enzymes [BR:sen01007]
 Aminotransferase (transaminase)
  Class III
   SACE_3418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Cambridge: 
Kitasato: 
UniProt: 
LinkDB All DBs
Position
3772373..3773680
Genome map
AA seq 435 aa AA seqDB search
MASTGVHTDLVKRRRAVLPDWLSLYYDEPIDLERGEGRHVWDAEGNRYLDFFGGILTTMT
AHALPEVTAAVSEQAARILHSSTLYLNRPMVELAERVAELSCIDEPRVFFTASGTEANDT
ALLLATGYRASNQVLALRNSYHGRSFSALGITGNRAWSPTSLSPVQTSYVHGSRRPGTPM
ADLPDEEFTDACVADLEDVLGQLNGNVACLIAEPVQGVGGFTTPPDGLFARFKEVLDRHG
ILWISDEVQTGWGRTGEHFWGWQAHAANGGPDIVTFAKGIGNGLSIGGVVARAEIMNSVA
ANSISTFGGSPVTAAGALANLDHLVAHDLQGNARQVGAVLREQLDAALGRLPALGDVRGK
GLMIGVELVHPGTGAPAPELATWALEETRRQGLLVGKGGMHGNVLRIAPPLSLTEEEARE
GARILLDVLEKAGRA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcaccggcgtgcacaccgacctggtcaagcggcgccgcgcggtactgccggac
tggctgtcgctgtactacgacgagccgatcgacctcgaacgcggcgagggcaggcacgtc
tgggacgcggagggcaaccgctacctggacttcttcggcgggatcctgaccaccatgacc
gcgcacgcgctgccggaggtgaccgccgcggtcagcgagcaggccgcgcgcatcctgcac
tcctcgacgctgtacctgaaccggccgatggtcgagctggccgaacgggtcgcggagctc
tcctgcatcgacgagccacgggtgttcttcaccgccagcggcaccgaggccaacgacacc
gcgctgctgctggccaccggctaccgggcgtcgaaccaggtcctcgcgctgcgcaacagc
taccacgggcggtcgttctcggcgctgggcatcaccggcaaccgggcctggtccccgacc
agcctgtcgccggtgcagacctcctacgtgcacggcagccgcaggccgggaacgccgatg
gcggacctgcccgacgaggagttcaccgacgcgtgcgtggccgatctcgaggacgtgcta
gggcagctcaacggcaacgtggcctgcctgatcgccgagccggtccagggcgtcggcggt
ttcaccacgccgccggacgggttgttcgcacggttcaaggaggtcctcgaccggcacggc
atcctgtggatcagcgacgaggtgcagaccggctggggccgcaccggcgagcacttctgg
ggctggcaggcgcacgccgccaacggcgggcccgacatcgtcaccttcgccaagggcatc
ggcaacggcctgtccatcggcggggtcgtggccagggccgagatcatgaacagcgtcgcg
gccaactccatctccaccttcggcggcagcccggtgaccgcggcgggcgcgctggccaac
ctcgaccacctcgtcgcccacgacctgcagggcaacgcccggcaggtcggcgcggtgctg
cgcgagcagctcgacgccgcgctggggcggctgcccgcgctgggcgacgtccggggcaag
ggactgatgatcggcgtcgagctggtccacccgggcaccggcgcgcccgcaccggagctg
gccacctgggcgctggaggagaccaggcggcaggggctgctcgtcggcaagggcgggatg
cacggcaacgtgctgcgcatcgctccaccgctgagcctgaccgaggaggaggcgcgcgag
ggcgcccgcatcctcctcgacgtactggagaaagcgggtcgcgcatga

DBGET integrated database retrieval system