KEGG   Saccharopolyspora erythraea: SACE_3549Help
Entry
SACE_3549         CDS       T00492                                 

Definition
(GenBank) DNA ligase (ATP)
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sen  Saccharopolyspora erythraea
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sen00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    SACE_3549
Enzymes [BR:sen01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SACE_3549
DNA repair and recombination proteins [BR:sen03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SACE_3549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Cambridge: 
Kitasato: 
UniProt: 
LinkDB All DBs
Position
complement(3908737..3909645)
Genome map
AA seq 302 aa AA seqDB search
MAGSDVTVEVSGRRLKLSNLDKVLYPVTGFTKRDVVDYYQRVAPAMLPHLRDRAATLIRF
PDGVGGFSFYEKNVGRHAPDWLPTVALISGAEGTGRALNHHVVVNDLPTLVWTANLAALE
LHVLQWKVDADGTRNPPDILVFDLDPGEPATIVDCCRVAELLHDVLRAEGLRPYPKTSGS
KGLQLYCPVRVDSPKRTSEYAKEIAQHMQAEHPESVVAKMAKAEREGKVFIDWSQNNTAK
TTVAPYSLRARARPTVSTPVTWDEVRGCTKPDELVFTSDDVLRRLDRHGDLMADMEDSPT
PL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcagcgacgtcaccgtcgaggtgtcgggccgccggctcaagctgtccaatctg
gacaaggtcctctaccccgtgaccgggttcaccaagcgcgacgtggtcgactactaccag
cgggtcgcgcccgcgatgctgccgcacctgcgcgaccgcgccgccacgctgatccggttc
ccggacggcgtgggcgggttctccttctacgagaagaacgtcggccgccacgcgcccgac
tggctgcccaccgtcgccctgatcagcggcgccgagggcaccgggcgcgcgctcaaccac
cacgtggtggtcaacgacctgccgacgctggtgtggacggcgaacctggccgcgctggag
ctgcacgtgctgcagtggaaggtcgacgccgacgggacccgaaacccgcccgacatcctg
gtgttcgacctcgaccccggcgaacccgccaccatcgtggactgctgccgggtggccgag
ctgctgcacgacgtcctgcgcgcggaggggctgcgcccctaccccaagaccagcggctcc
aagggactccagctctactgcccggtgcgcgtggactcgccgaagcgcacctcggagtac
gccaaggagatcgcccagcacatgcaggccgaacacccggagtcggtcgtggcgaagatg
gccaaggccgagcgcgagggcaaggtgttcatcgactggagccagaacaacaccgccaag
accaccgtcgccccgtactcgctgcgcgcacgggccaggccgacggtgtccacaccggtc
acctgggacgaggtccgcggctgcaccaaaccggacgagctggtcttcaccagcgacgac
gtgctgcggcggctggaccgccacggcgacctcatggccgacatggaggactcgcccacc
ccgctgtga

DBGET integrated database retrieval system