KEGG   Saccharopolyspora erythraea: SACE_6200Help
Entry
SACE_6200         CDS       T00492                                 

Definition
(GenBank) possible transferase
  KO
K16150  glycogen synthase [EC:2.4.1.11]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00500  Starch and sucrose metabolism
sen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SACE_6200
Enzymes [BR:sen01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     SACE_6200
Glycosyltransferases [BR:sen01003]
 Polysaccharide
  Storage polysaccharide
   SACE_6200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_transf_4 Glyco_trans_4_4 Glyco_trans_1_4 Glyco_transf_5 Glyco_trans_1_2 Glyco_trans_4_2 Glyco_trans_4_3
Motif
Other DBs
NCBI-ProteinID: CAM05373
Cambridge: SACE_6200
Kitasato: SACE_6200
UniProt: A4FMU8
LinkDB All DBs
Position
6948602..6949861
Genome map
AA seq 419 aa AA seqDB search
MRVLMLSWEYPPVVVGGLGRHVHALARTLAGQGHDVVVLCRQPAGTDPETHPASDTVVDG
VRLVRVAEDPPHLTFERDLVAWTLAMGHAMVRAGQRLLRGWRPDVVHAHDWLVTHPAIAL
AEAAEVPLVATIHATEAGRHSGWLSQIHSQQIHSVEWWLANRADELITCSAAMRAEAAEL
FDVDPASITVLHNGIETRTWQVRAHDVAAARRSHGRDGAPLLLYFGRLEWEKGVQDLLAA
LPAIRERHPGTTVAIAGCGTHQEWLVERAAEHGVSEAARFTGHLPDTELASLLAAADAVV
LPSRYEPFGIVALEAAAASAPLVASTAGGLGEIVLDGSTGLAFAPGDVAGLADAVDRVLC
DPEAAERRAEAAKARLSSDFDWERIAEGTAAVYAGARRREHAELPRPKIATGNVLGRGE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgctgatgctgtcctgggaatacccgccggtcgtggtcggcgggctcggccgc
catgtccacgcgctggcccgcaccctggccgggcagggccacgacgtcgtcgtgctgtgc
cgccagccggccgggaccgacccggagacgcacccggccagtgacaccgtcgtcgacggc
gtccggctggtgcgggtcgccgaggacccgccgcacctgaccttcgaacgcgacctcgtc
gcctggacgctggcgatgggccacgcgatggtccgcgcgggccagcgcctgctgcgcgga
tggcggccggacgtcgtgcacgcccacgactggctggtcacccacccggccatcgcgctg
gccgaagccgccgaggtgccgctggtcgccaccatccacgccaccgaggcgggacggcac
agcggctggctgtcgcagatccacagccagcagatccactcggtcgagtggtggctggcg
aaccgggcggacgagctgatcacctgctcggcggcgatgcgggccgaggcggccgagctg
ttcgacgtcgatccggcgtcgatcacggtgctgcacaacgggatcgagacgcggacctgg
caggtccgcgcccacgacgtggccgcggcgcggcgctcgcacgggcgcgacggcgcaccg
ctgctgctctacttcggcaggctggagtgggagaagggcgtccaggacctgctggccgcg
ctgcccgccatccgggagcgccaccccggcacgaccgtggccatcgcgggctgcgggacg
caccaggagtggctcgtcgagcgggccgccgagcacggcgtctccgaggccgcgcgcttc
accgggcacctgcccgacaccgagctggcctccctgctggcggccgcggacgcggtggtg
ctgcccagccgctacgagccgttcggcatcgtcgcgctggaggccgccgccgcgagcgcg
ccgctggtcgcctccaccgcgggcggtctcggcgagatcgtgctcgacgggagcaccggg
ctggcgttcgcaccgggggacgtggccggcctcgccgacgcggtcgaccgggtgctgtgc
gacccggaggcggccgagcgccgcgccgaggcggcgaaggcccggctgagcagcgacttc
gactgggaacgcatcgcggagggcaccgccgccgtctacgcgggcgcgcgccgccgtgag
cacgcggagctgccccgcccgaagatcgccaccggcaacgtgctgggtcgcggcgaatag

DBGET integrated database retrieval system