KEGG   Salmonella enterica subsp. enterica serovar Bovismorbificans: BN855_35990Help
Entry
BN855_35990       CDS       T02827                                 

Definition
(GenBank) hypothetical protein
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
senb  Salmonella enterica subsp. enterica serovar Bovismorbificans
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:senb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BN855_35990
Enzymes [BR:senb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BN855_35990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3559862..3561370
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGVRFGADSVLKPEIVRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATAARRENG
LWIVEAEDIDTGKKYVWQARGLVNATGPWVKQFFDEGMHLPSPYGIRLIKGSHIVVPRVH
NQKQAYILQNEDKRIVFVIPWMEEFSIIGTTDVEYKGDPKAVKIEESEINYLLKVYNAHF
QKQLGRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHAMEKLASYYPGIGPAWTKTCVLPGGDIDGSREDYAAKLRRRYPFLTESLARHYSRT
YGSNTEWILGEATSLLDLGEDFGHEFYEAELKYLVDHEWVRRTEDAIWRRTKEGMWLTAE
QQSRITQWLAAYVEKHQLSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgatcgtgataggcgggggcattaacggtgcaggcatcgcggct
gatgccgccggacgcggtttgtccgtactcatgctggaagcgcaggatttggcctgcgcg
acctcttccgccagttcgaagcttatccacggtggcttacgctaccttgaacactacgag
ttccgcctggtcagcgaagcgctggcagaacgtgaggtactgttgaaaatggcgccgcac
atcgccttcccgatgcgttttcgtctgccgcaccgcccgcatttacgtccggcctggatg
atccgtatcggtctgtttatgtacgatcacctcggcaaacgtaccagtttacccggttcc
accggtgtgcggtttggcgcagattcggtgctcaaaccggaaatcgtgcgcggattcgaa
tattccgactgctgggtagacgatgcgcgtctggtgctggctaacgcacagatggtggtg
cgtaaaggcggcgaagtccttacccgtactcgcgcaaccgccgctcgtcgggaaaatggc
ctgtggattgtcgaagcggaagatatcgacaccggtaaaaaatatgtctggcaggcgcgc
ggactggttaacgccaccggaccgtgggtcaaacagttcttcgacgaagggatgcacctg
ccgtcgccatatggcatccgcctgatcaaaggcagccatatcgtcgtgccgcgcgtccat
aatcagaagcaggcgtatattctgcaaaacgaagataagcgtatcgtctttgtcattccg
tggatggaagagttttcgatcattggcacaaccgatgtcgaatataaaggcgatccgaaa
gcggtaaaaattgaagagagcgaaattaattacctgttgaaggtctataacgcgcacttc
cagaaacaactggggcgcgatgacatcgtctggacgtactccggcgtccgtccgctgtgc
gatgatgagtccgactcaccgcaggcgatcactcgcgattatacccttgatatccatgat
gaaaacggcaaagcgccgctgctttccgtgtttggcggtaagctcacgacctaccgtaag
ctggccgaacatgcgatggaaaaactggcgtcttattatccaggcatcgggccggcatgg
accaaaacgtgcgtactgcccggcggcgacatcgacggcagccgcgaagattacgcggcg
aagctgcgtcgtcgttacccattcctgacggaatcgctggcgcgccactattcgcgcact
tacggcagcaacacggagtggattctcggcgaagccacgtcactgcttgatttaggcgaa
gatttcggtcatgagttttacgaggcggaactcaagtacctggtggatcacgaatgggtg
cgccgtactgaagacgctatctggcgtcgcaccaaagaaggcatgtggctgaccgccgag
cagcagtcccgcatcacccagtggctggcggcgtatgttgagaaacaccaactttcactg
gcgtcgtaa

DBGET integrated database retrieval system