KEGG   Salmonella enterica subsp. enterica serovar Tennessee: SEET0819_00825Help
Entry
SEET0819_00825    CDS       T03730                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
senc  Salmonella enterica subsp. enterica serovar Tennessee
Brite
Translation factors [BR:senc03012]
 Eukaryotic Type
  Elongation factors
   SEET0819_00825 (tuf)
 Prokaryotic Type
   SEET0819_00825 (tuf)
Mitochondrial biogenesis [BR:senc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SEET0819_00825 (tuf)
Exosome [BR:senc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SEET0819_00825 (tuf)
  Exosomal proteins of breast cancer cells
   SEET0819_00825 (tuf)
  Exosomal proteins of colorectal cancer cells
   SEET0819_00825 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(148642..149826)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GDAEWEAKIIELAGFLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKETQKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgtacaaaaccgcacgttaacgtcggcaccatcggccac
gttgaccacggtaaaactaccctgaccgctgcaatcaccaccgtactggctaaaacctac
ggcggtgctgctcgtgcattcgaccagatcgataacgctccggaagaaaaagcgcgtggt
atcaccatcaacacttctcacgttgaatacgataccccgacccgccactacgcacacgta
gactgcccggggcacgccgactatgttaaaaacatgatcaccggtgctgcgcagatggac
ggcgcgatcctggttgttgctgcgactgacggcccgatgccgcagacccgtgagcacatc
ctgctgggtcgtcaggtaggcgttccgtacatcatcgtgttcctgaacaaatgcgacatg
gttgatgacgaagagctgctggaactggttgaaatggaagttcgtgaacttctgtctcag
tacgacttcccgggcgacgacacgccgatcgttcgtggttctgctctgaaagcgctggaa
ggcgacgcagagtgggaagcgaaaatcatcgaactggctggcttcctggattcttacatt
ccggaaccagagcgtgcgattgacaagccgttcctgctgccgatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgtagaacgcggtatcatcaaagtgggc
gaagaagttgaaatcgttggtatcaaagagactcagaagtctacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgccggtgagaacgtaggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggtactggctaagccgggcaccatcaag
ccgcacaccaagttcgaatctgaagtgtacattctgtccaaagatgaaggcggccgtcat
actccgttcttcaaaggctaccgtccgcagttctacttccgtactactgacgtgactggc
accatcgaactgccggaaggcgtagagatggtaatgccgggcgacaacatcaaaatggtt
gttaccctgatccacccgatcgcgatggacgacggtctgcgtttcgcaatccgtgaaggc
ggccgtaccgttggcgcgggcgttgttgctaaagttctgggctaa

DBGET integrated database retrieval system