KEGG   Salmonella enterica subsp. enterica Serovar Heidelberg CFSAN002069: CFSAN002069_20105Help
Entry
CFSAN002069_20105 CDS       T02735                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
senh  Salmonella enterica subsp. enterica Serovar Heidelberg CFSAN002069
Brite
Enzymes [BR:senh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     CFSAN002069_20105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2937876..2938523
Genome map
AA seq 215 aa AA seqDB search
MIDLYYAPTPNGHKITLFLEEAELAYRLLKVDISKGNQFRPDFLAISPNNKIPAIVDHAP
ADGGQPLSLFESGEILLYLAEKSGKLLSGELRERHTTLQWLFWQVGGLGPMLGQNHHFNH
FAPQAIPYAIERYQVETQRLYNVLNKRLETSPWLGGDHYSIADIASWPWVNAHQRQRIDL
DSYPAVYNWFERIRTRPATARALLQAQLHCNSAKA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgattgacctttactacgcccccacgcccaacgggcataaaataacgctgtttctggaa
gaggcggagctggcgtatcgtttgctaaaagtagatatcagcaagggcaatcagtttcgc
cctgattttttggctatctctcccaataataaaattcctgccatcgtcgatcacgccccg
gcagacggcggtcaaccgcttagtctttttgaatccggcgaaattcttctctacctggcg
gaaaaaagcggcaaactgcttagcggggagctgcgtgaacgccataccacgctgcaatgg
ctgttctggcaggtcggcgggttagggccgatgctgggccagaatcatcactttaaccat
tttgcgccgcaggccatcccctatgcgattgaacgctatcaggttgaaacgcaacgctta
tacaacgtcctgaataaacgcctggaaacctccccgtggctgggcggcgaccactacagt
attgcggatatcgccagttggccgtgggttaacgcacatcagcgtcagcgaatcgatctt
gatagctacccggcggtgtataactggtttgaacgcattcgcacgcgtcctgcgacagcg
cgcgcactgttacaagcgcaactgcactgtaacagtgcgaaagcgtaa

DBGET integrated database retrieval system