KEGG   Salmonella enterica subsp. enterica serovar Javiana: CFSAN001992_12645Help
Entry
CFSAN001992_12645 CDS       T02479                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
senj  Salmonella enterica subsp. enterica serovar Javiana
Pathway
senj00473  D-Alanine metabolism
senj01100  Metabolic pathways
senj01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:senj00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CFSAN001992_12645 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CFSAN001992_12645 (alr)
Enzymes [BR:senj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CFSAN001992_12645 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:senj01011]
 Precursor biosynthesis
  Racemase
   CFSAN001992_12645 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AGF82829
LinkDB All DBs
Position
complement(2572358..2573437)
Genome map
AA seq 359 aa AA seqDB search
MQAATVVINRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADAFGVARL
EEALRLRAGGITQPILLLEGFFDAADLPTISAQCLHTAVHNQEQLAALEAVELAEPVTVW
MKLDTGMHRLGVRPEEAEAFYQRLTHCKNVRQPVNIVSHFARADEPECGATEHQLDIFNA
FCQGKPGQRSIAASGGILLWPQSHFDWARPGIILYGVSPLEHKPWGPDFGFQPVMSLTSS
LIAVRDHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGR
VAMDMICVDLGPNAQDNAGDPVVLWGEGLPVERIAEMTKVSAYELITRLTSRVAMKYID
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcggcaacagtcgtcattaaccgccgcgctctgcgacacaacctgcaacgtctg
cgtgaactggcgcctgccagtaagctggttgcggtggtgaaagcgaacgcttatggacac
ggtcttctggagaccgcgcgaacgctccctgatgctgacgcttttggcgtggcgcgtctt
gaagaggctctacgtctgcgagcgggcgggatcacgcagcctatcctgctgctggagggt
tttttcgacgccgccgatctgccgaccatttccgcgcaatgtctgcataccgccgtacat
aatcaggagcagcttgccgccctggaggcggtggagctggcggagccagtaacggtctgg
atgaaactggataccggtatgcatcgtctcggcgtgcgtcccgaagaggcggaggcgttc
taccagcgtctgacgcactgtaaaaatgtacgccagccggtgaatatcgtcagccatttt
gcccgtgcggatgagccggaatgcggcgctaccgaacatcagctcgacatttttaatgcc
ttctgtcagggtaaacccggtcagcgctctattgccgcgtctggcggtattctgctgtgg
ccgcagtctcactttgactgggcgcgtccgggcatcattttgtatggcgtatcgccgctg
gaacacaaaccctgggggccggattttggttttcagccggtgatgtctttaacctccagt
ttgatcgcggtgcgtgaccacaaagcgggcgaaccggtgggctacggcgggacatgggtg
agtgagcgcgacacgcgcctgggcgtggtggctatgggttatggcgatggctacccacga
gcggcgccttccggtacgccagtgctggtcaatggtcgtgaagtcccgattgtcgggcgg
gtggcgatggatatgatttgcgtggatttggggccaaacgcgcaggataacgcgggcgat
ccggtggtcttatggggcgaaggtctgccggttgaacgtatcgctgaaatgacaaaagta
agtgcttacgaacttatcacgcgcctgacttcaagggtggcgatgaagtatattgattaa

DBGET integrated database retrieval system