KEGG   Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1: SN31241_11140Help
Entry
SN31241_11140     CDS       T02779                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
senn  Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:senn00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SN31241_11140
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SN31241_11140
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SN31241_11140
Enzymes [BR:senn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SN31241_11140
Peptidoglycan biosynthesis and degradation proteins [BR:senn01011]
 Precursor biosynthesis
  Amino acid ligase
   SN31241_11140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1141009..1141929
Genome map
AA seq 306 aa AA seqDB search
MADKIAVLLGGTSAERDVSLNSGAAVLAGLREGGIDAHPVDPQEVDVAQLKAMGFQKVFI
ALHGRGGEDGTLQGMLELLGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVAPWVALTRA
EFEKGLSEEQKARISALGLPLIVKPSREGSSVGMTKVVEENALQGALSLAFQHDDEILIE
KWLCGPEFTVAIVGEEILPSIRIQPAGTFYDYEAKYLSDETQYFCPAGLDASQEAALQSL
VLQAWKALGCTGWGRIDVMLDSDGQFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVR
ILELAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaatcgcggtcctgttgggcggaacctctgcggagcgggacgtttcgtta
aattccggcgcggcagtgttggccgggttacgtgaaggcggtattgatgcgcatcccgtc
gatccgcaagaggtcgatgtcgcgcagcttaaagcaatgggctttcagaaggtctttatt
gcgttgcatggccgcggcggtgaagatggcaccttacagggaatgcttgaactgctcggc
ctgccttataccggcagcggcgtgatggcctcggcgctttccatggataaactgcgcagt
aaattgctgtggcagggcgcaggcttaccggttgcgccgtgggtcgcgctgacgcgcgct
gagtttgaaaaaggccttagcgaagaacaaaaagcgcgaatttcggcgctgggtttaccg
ctgatcgtcaaacccagccgtgaaggctccagcgtcggtatgacgaaagtagtagaagaa
aatgctttacagggtgcgttatcattggcttttcagcatgatgacgaaatactgattgag
aaatggctgtgcggtccggaatttacggtggcgatagttggcgaagaaattttaccgtca
attcgtatccaaccggcaggaaccttctatgattatgaggcgaagtatctctctgatgag
actcagtatttctgccctgccggtttagatgcgtcccaggaagccgcgctacagtctctc
gtcctgcaggcatggaaagctttaggctgcacgggatgggggcgtattgacgtcatgctg
gacagcgatggtcagttttatctgctggaagccaatacttctccggggatgaccagccat
agtctggtgccgatggcggcgcgtcaggcgggaatgagcttctcgcagttagtggtacga
attctggagttggcggactga

DBGET integrated database retrieval system