KEGG   Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1: SN31241_33890Help
Entry
SN31241_33890     CDS       T02779                                 

Definition
(GenBank) Anaerobic glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
senn  Salmonella enterica subsp. enterica serovar Newport USMARC-S3124.1
Pathway
senn00564  Glycerophospholipid metabolism
senn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:senn00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SN31241_33890
Enzymes [BR:senn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SN31241_33890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 DAO_C Pyr_redox_2 FAD_oxidored 3HCDH_N NAD_binding_8 HI0933_like FtsA Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AGS30361
LinkDB All DBs
Position
3417626..3419224
Genome map
AA seq 532 aa AA seqDB search
MIIIGGGATGAGIARDCALRGLRVILVERHDIATGATGRNHGLLHSGARYAVTDAESARE
CISENQILKRIARHCVEPTDGLFITLPEDDLAFQATFIRACEAAGIRAEAIDPQQARIIE
PSVNPALIGAVKVPDGTVDPFRLTAANMLDAREHGAIVLTAHEVTGLIREGATVCGVHVR
NHLTGETQTLHAPVVVNAAGIWGQRIAEYADLSIRMFPAKGSLLIMDHRINQHVINRCRK
PSDADILVPGDTISLIGTTSTHIDYNEIDSNRVTADEVDILLREGEKLAPVMAKTRILRA
YSGVRPLVASDDDPSGRNVSRGIVLFDHAERDGLEGFITITGGKLMTYRLMAEWATDAVC
RKLGNTRPCITADTPLPGSKESTEYTLKRIISLPAPLRGSAVYRHGDRTPGWLSEGRQHR
SLVCECEAVTAGEVQYAVENLTVNSLLDLRRRTRVGMGTCQGELCACRAAGLLQRFNVTT
AAQSITQLSEFLNERWKGVQPVAWGDALRESEFTRWVYQGLCGLEKEHQDEI
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
gtgattatcattggcggtggagcaacaggcgcagggatcgcccgcgactgcgcgctgcga
ggtttacgtgtcattctggtggagcggcatgatatagcgaccggcgcgaccgggcgtaac
cacgggctgctgcacagcggcgctcgttatgcggttaccgacgcggaatccgcgcgcgag
tgcattagtgaaaaccagattttaaaacggatcgcccgccattgcgtcgaaccgacggat
ggtctgtttattacgttgccggaagatgatcttgcgtttcaggccacctttattcgcgcc
tgtgaagcggcaggcattcgcgctgaagccatcgatccgcagcaggctcgcatcatcgaa
ccttccgttaaccctgcgctcatcggtgcggtaaaagtgccggatggcaccgtggaccct
ttccgccttaccgccgccaatatgctggatgccagagaacatggcgcaatcgtgttaacg
gcgcatgaagtgaccgggctcattcgtgaaggcgcaacggtctgcggcgtccatgtgcgc
aaccatctcactggcgaaacccagacgcttcacgcgccggtggtggtcaatgcggcaggt
atctgggggcaacggatcgccgaatacgccgacctgagtattcgcatgttcccggcgaaa
ggctcgctgttgatcatggaccatcggatcaaccagcatgtcattaaccgctgccggaaa
ccatcggatgccgacattctggtacctggcgatacgatttcactgatcggcaccacctct
acccatattgattacaatgagatagacagcaaccgcgtcaccgcagatgaagtcgatatc
ctgctgcgtgaaggggaaaaactggcccctgtcatggcgaagacgcgtattctgcgcgcg
tattccggcgtccgcccgctggtggccagcgatgacgatcccagcggtcgtaacgtcagc
cgcggtattgtgttgttcgaccacgccgaacgcgacgggcttgaaggcttcattaccatt
accggcgggaagctaatgacttaccgcctgatggcggaatgggcgaccgacgccgtgtgc
cgcaagttgggcaatactcgcccctgcatcacggcggatacgccgttgcctggctcaaaa
gagtctacggaatatacgctgaaacgcattatctcgcttcccgcgccgctacgcggatcg
gcggtttatcggcatggcgatcgcacgccggggtggctgagtgaaggccgccaacaccgt
agcctggtctgtgaatgcgaggccgtcacggcgggggaagtgcagtatgccgtcgaaaac
ttaaccgtgaacagcctgctggatctgcgccgtcgcacccgcgtagggatgggcacttgc
cagggcgagctatgcgcctgccgcgcggccgggctattgcagcgttttaatgtgacgacc
gcggcgcaatctattacgcaactctctgaatttctgaatgagcgctggaaaggcgtacaa
cctgtcgcctggggagacgcgctgcgcgaaagcgaattcacgcgctgggtttatcaggga
ttatgcggtctggagaaggagcaccaggatgaaatttga

DBGET integrated database retrieval system