KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090531: AU40_13105Help
Entry
AU40_13105        CDS       T03761                                 

Definition
(GenBank) aminotransferase
  KO
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
senq  Salmonella enterica subsp. enterica serovar Enteritidis EC20090531
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:senq00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AU40_13105
   00290 Valine, leucine and isoleucine biosynthesis
    AU40_13105
   00220 Arginine biosynthesis
    AU40_13105
Enzymes [BR:senq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     AU40_13105
    2.6.1.66  valine---pyruvate transaminase
     AU40_13105
Amino acid related enzymes [BR:senq01007]
 Aminotransferase (transaminase)
  Class I
   AU40_13105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2392180..2393394
Genome map
AA seq 404 aa AA seqDB search
MSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFEAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGD
EMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLMEIVNIAREHNLIIFADEIYDKILYDDAEHHSIAALAPDLLTITFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
LPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPRIDAKRFNIHDDQKMVLDFLLQEK
VLLVQGTAFNWPWPDHFRIVTLPREDDLEMAINRFGRFLSGYHQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccattgaaaaatccagcaaactcgaaaatgtctgttatgacattcgtggcccc
gttctgaaagaagcgaaacgccttgaggaagaaggtaataaagttcttaaactgaatatc
ggcaaccccgcccccttcggattcgaagcgccggacgaaattctggtcgatgtcattcgt
aatttgccgacggcgcaaggatattgcgactcgaaagggctttattctgcccgtaaagcg
attatgcaacattatcaggcccgtggaatgcgcgatgtaaccgtggaagatatctatatc
ggtaacggcgtttccgagctgatcgttcaggcgatgcaggcgttgcttaacagtggcgat
gaaatgctggttcccgcgcccgattatccgttatggacagcggcggtatcgctctccagc
ggcaaggcggtacattatctttgcgatgaatcttccgactggttcccggaccttgacgat
atccgcgccaaaatcaccccacgtacgcgtggtattgtcattattaatccaaacaaccct
actggcgccgtctattctaaagaattgttgatggaaattgtcaacattgcgcgcgagcat
aatctcatcatcttcgccgatgaaatttatgacaagattctctatgacgatgccgagcat
cactctatcgccgcactggcacctgatctgctgaccatcacctttaatgggttgtctaaa
acctatcgcgtcgccggcttccgccagggctggatggtgctgaacgggccgaaaaaacat
gcgaagggctatattgaagggctggagatgttagcctcaatgcgcctgtgcgccaacgtc
ccggcgcaacatgctattcagaccgcgctcggcggctatcaaagcattagcgaatttatt
ctgccgggcggtcgactgtatgaacagcgtaaccgcgcctgggagttgattaacgatatc
cccggcgtttcctgcgtaaaaccgcgcggcgcgttgtacatgttccccaggatcgacgct
aaacgttttaatattcacgacgaccagaagatggtgctggacttcctgctacaggaaaag
gtgctgctggtgcaaggtaccgcctttaactggccgtggccggatcacttccgcattgtg
acgctaccgcgtgaagatgacctggagatggccatcaaccgttttgggcgtttcctctca
ggttaccatcaataa

DBGET integrated database retrieval system