KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090531: AU40_13210Help
Entry
AU40_13210        CDS       T03761                                 

Definition
(GenBank) GSH-dependent disulfide bond oxidoreductase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
senq  Salmonella enterica subsp. enterica serovar Enteritidis EC20090531
Brite
Enzymes [BR:senq01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     AU40_13210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2410612..2411259
Genome map
AA seq 215 aa AA seqDB search
MIDLYYAPTPNGHKITLFLEEAELAYRLLKVDISKGNQFRPDFLAISPNNKIPAIVDHAP
ADGGQPLSLFESGEILLYLAEKSGKLLSGELRERHTTLQWLFWQVGGLGPMLGQNHHFNH
FAPQAIPYAIERYQVETQRLYNVLNKRLETSPWLGGDHYSIADIASWPWVNAHQRQRIDL
DTYPAVYNWFERIRTRPATARALLQAQLHCNSTKA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgattgacctttactacgcccccacgcccaacgggcataaaataacgctgtttctggaa
gaggcggagctggcgtatcgtttgctaaaagtagatatcagcaagggcaatcagtttcgc
cctgattttttggctatctctcccaataataaaattcctgccatcgtcgatcacgccccg
gcagacggcggtcaaccgcttagtctttttgaatccggcgaaattcttctctacctggcg
gaaaaaagcggcaaactgcttagcggggagctgcgtgaacgccataccacgctgcaatgg
ctgttctggcaggtcggcgggttagggccgatgctgggccagaatcatcactttaaccac
tttgcgccgcaggccatcccctatgcaattgaacgctatcaggttgaaacgcaacgctta
tacaacgtcctgaataaacgcctggaaacctccccgtggctgggcggcgaccactacagt
attgcggatatcgccagttggccgtgggttaacgcacatcagcgtcagcgaatcgatctt
gatacctacccggcggtgtataactggtttgaacgcattcgcacgcgtcctgcgacagcg
cgcgcactgttacaagcgcaactgcactgtaacagtacgaaagcgtaa

DBGET integrated database retrieval system