KEGG   Salmonella enterica subsp. enterica serovar Enteritidis EC20090531: AU40_22740Help
Entry
AU40_22740        CDS       T03761                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
senq  Salmonella enterica subsp. enterica serovar Enteritidis EC20090531
Brite
Translation factors [BR:senq03012]
 Eukaryotic Type
  Elongation factors
   AU40_22740 (tuf)
 Prokaryotic Type
   AU40_22740 (tuf)
Mitochondrial biogenesis [BR:senq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    AU40_22740 (tuf)
Exosome [BR:senq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AU40_22740 (tuf)
  Exosomal proteins of breast cancer cells
   AU40_22740 (tuf)
  Exosomal proteins of colorectal cancer cells
   AU40_22740 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
4182117..4183301
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GDAEWEAKIIELAGFLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKETQKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccatggtaaaacaacgctgaccgctgccattactaccgtactggctaaaacctac
ggcggtgccgcccgcgcattcgaccagatcgataacgcgccggaagaaaaagcgcgtggt
atcaccatcaacacttctcacgttgaatacgataccccgacccgccactacgcacacgta
gactgcccggggcacgccgactatgttaaaaacatgatcaccggtgctgctcagatggac
ggcgcgattctggttgttgctgcgactgacggcccgatgccgcagacccgtgagcacatc
ctgctgggtcgtcaggtaggcgttccgtacatcatcgtgttcctgaacaaatgcgacatg
gttgatgacgaagagctgctggaactggttgaaatggaagttcgtgaacttctgtctcag
tacgacttcccgggcgacgacactccgatcgttcgtggttctgctctgaaagcgctggaa
ggcgacgcagagtgggaagcgaaaatcatcgaactggctggcttcctggattcttacatc
ccggaaccagagcgtgcgattgacaagccgttcctgctgccgatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgtagaacgcggtatcatcaaagtgggc
gaagaagttgaaatcgttggtatcaaagagactcagaagtctacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgccggtgagaacgtaggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggtactggctaagccgggcaccatcaag
ccgcacaccaagttcgaatctgaagtgtacattctgtccaaagatgaaggcggccgtcac
actccgttcttcaaaggctaccgtccgcagttctacttccgtactactgacgtgactggc
accatcgaactgccggaaggcgtagagatggtaatgccgggcgacaacatcaaaatggtt
gttaccctgatccacccgatcgcaatggacgacggtctgcgtttcgcaatccgtgaaggc
ggccgtaccgttggcgcgggcgttgttgctaaagttctcggctaa

DBGET integrated database retrieval system