KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty21a: TY21A_17690Help
Entry
TY21A_17690       CDS       T02648                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sent  Salmonella enterica subsp. enterica serovar Typhi Ty21a
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sent00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TY21A_17690
  Energy metabolism
   00680 Methane metabolism
    TY21A_17690
Enzymes [BR:sent01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     TY21A_17690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3598953..3601604
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGETIKDALGEHILDRVETIRKLSKSSRAGNEANRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPKGEAASNPEVIAHTLRKLKNQPDLNDA
TIKKAVESLSLELVLTAHPTEITRRTLIHKMGEINNCLKQLDNTDIADYERHQVMRRLRQ
LIAQSWHTDEIRKQRPSPVDEAKWGFAVVENSLWQGVPNYLRELNEQLEENLGYKLPVDF
VPVRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKATDLFLKDIHVLVSELSMVDATPELL
ALVGEEGASEPYRYLMKKLRARLMATQSWLEARLKGEKLPKPAGLLTQNEQLWEPLYACY
QSLQACGMGIIANGELLDTLRRVKCFGVPLVRIDIRQESTRHTEALGEITRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRNWEPSNDTREVLETCKVIAETPKGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFAMPVAPLFETLDDLNNADDVMTQLLNIDWYRGLIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTVSSLSLYTSAILEANLLPPPEPKDSWRHIMDEL
SVISCETYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGTALQKVVEDGKQSELEAMCRDWPFFSTRLGMLEMVFSKADLWLAD
YYDQRLVAKTLWPLGKELRDLLEEDIKVVLAIANDSHLMADLPWIAESIQLRNVYTDPLN
VLQAELLYRSRLTEEQGKSPDPRVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcgttgcgtagtaatgtcagtatgctcggcaaggtgctggga
gaaaccatcaaggatgcgctgggagagcacattcttgatcgcgtagaaacaatccgtaag
ctatccaaatcttcacgcgccggcaatgaagctaatcgccaggagctgctcaccacgcta
caaaatttgtctaatgacgagctgctgccagttgcgcgcgcgtttagtcagttcctgaac
ctggccaatactgccgagcaataccacagcatttcgccaaaaggcgaagccgccagcaac
ccggaagtgattgcccacactctgcgtaaactgaaaaaccaaccggacctcaacgacgca
accatcaaaaaagcggtagagtcgctgtctttggagttggtgctaaccgcccacccgaca
gaaattacccgccgtacgcttattcacaagatgggggaaatcaataactgtctgaaacag
cttgataataccgatatcgccgactacgaacgccaccaggtgatgcgtcgcctgcgccag
ttgattgcccaatcctggcatacggatgagatccgcaagcagcgcccaagcccggtggat
gaagccaaatggggcttcgccgtggttgagaacagcctgtggcagggcgtacctaactat
ctgcgtgaactgaatgaacaactggaagaaaatctcggctacaaattgccggtggatttt
gtgccggtacgttttacctcctggatgggcggcgaccgagacggcaacccgaacgtgacg
gcggagatcacccgccacgtactcttgttaagccgctggaaagccaccgatctgttcctg
aaagacattcatgtcctggtatcagaactgtcgatggtcgacgccacgccggagctgctg
gcgttagtgggcgaagaaggcgcgtctgagccgtatcgctacctgatgaaaaaattgcgc
gcccgtctgatggcgacccagtcctggctggaagcgcgtctgaaaggcgagaagctgccc
aaaccggctggcctgctgacgcaaaacgagcagctctgggaacctctgtacgcctgctac
cagtcgttacaggcctgtggcatgggcattatcgccaacggcgagttactcgacacgctc
cgccgcgtgaagtgtttcggcgtaccgctggtgcgtattgatatccgtcaggagagcacc
cgccataccgaagcgctgggcgaaattacccgctacctcggtattggcgactacgaaagc
tggtcggaagccgacaagcaggccttcctgatccgcgagctgaactccaaacgtccgctg
ctgccgcgtaactgggagccgagcaacgatacccgcgaagtgcttgaaacctgcaaggtt
attgccgaaacgccaaaagggtcgatcgccgcctacgtgatttctatggcgaaaacgccg
tctgatgtgctggctgtgcatttgctgctgaaagaggcaggtatcggctttgccatgccg
gtcgcaccgctgtttgaaaccctcgacgacctgaacaatgccgacgacgtgatgacccag
ttgttgaatatcgactggtatcgcgggctgattcagggtaagcagatggtcatgatcggc
tactccgactcggcaaaagacgccggcgttatggccgcgtcatgggcgcagtatcaggcg
caggacgccctgatcaaaacctgtgaaaaagccggcatcgagctcactctcttccacggc
cgcggcggctctattggccgtggcggcgcgccagcccacgcggcgctgctttcgcaaccg
ccaggcagtctgaaaggcggtctgcgcgtgaccgagcagggcgagatgatccgcttcaaa
tacggcctgccggaagtcaccgtcagcagcctctcgctctacaccagcgcaattctggaa
gcaaacctgctgccgccgccggaaccgaaagacagctggcgtcatattatggatgagctt
tccgtcatctcctgtgaaacctaccgcggttacgtgcgcgaaaataaagactttgtaccg
tacttccgctccgcgacgccggaacaagagctgggcaaattgccgctcggctcacgtccg
gcgaaacgtcgtccaactggcggcgtcgaatcgctgcgcgcgattccgtggatcttcgcc
tggacgcaaaaccgcctgatgctgccagcctggctgggcgcgggtactgcgctgcaaaaa
gtggtggaagacggtaaacaaagcgaactggaagccatgtgccgcgactggccgttcttc
tccacgcgtcttgggatgctggaaatggtgttctcgaaagccgacctgtggctggccgac
tattacgatcagcgcctggtggcgaaaacgctttggccgctgggcaaagagctacgagac
ctactggaagaagacattaaagtggtgctggcgattgccaacgattcgcacctgatggcc
gacttaccgtggattgcggagtccattcagttaagaaacgtttataccgatccattaaac
gtgttgcaggccgaattgctgtatcgttcccgtctgactgaagagcagggcaaatcgccc
gatcctcgcgtcgaacaggcgttgatggtcacgattgcgggcgtcgccgccggtatgcgc
aacaccggctaa

DBGET integrated database retrieval system