KEGG   Staphylococcus epidermidis ATCC 12228: SE1681Help
Entry
SE1681            CDS       T00110                                 

Gene name
ddl
Definition
(RefSeq) D-alanyl-alanine synthetase A
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SE1681 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SE1681 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SE1681 (ddl)
Enzymes [BR:sep01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SE1681 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:sep01011]
 Precursor biosynthesis
  Amino acid ligase
   SE1681 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1738930..1740003)
Genome map
AA seq 357 aa AA seqDB search
MTKENICIVFGGKSAEHDVSILTAQNVLNAIDKERYQVDIIYITNDGEWKKKDNITQEIK
NTDELVINDVETGEISQLLSKGSLGKSYDAVFPLLHGPNGEDGTIQGLFEVLDIPYVGNG
VLAASSSMDKLVMKQLFEHRGLPQLPYISFLRSEYEKYENNIIKLVNDKLTYPVFVKPAN
LGSSVGISKCNNEEELKSGITEAFQFDRKLVIEQGINAREIEVAVLGNDYPETTWPGEVV
KDVAFYDYKSKYKDGKIRLDIPADLDQDVQMTLRNMALEAFKATDCSGLVRADFFVTDDN
QIYINETNAMPGFTAYSMYPNLWKNMGLSYPDLIAKLIDLAKERYEDKKKNKYKIDY
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagaaaatatttgtatcgtttttggaggtaaaagtgcagaacacgatgtttca
attttaactgcacaaaatgttttaaacgcaattgataaagaacgatatcaagttgatatc
atttatataacaaacgatggtgaatggaagaaaaaagataatattacacaagaaataaaa
aatactgatgaactcgtcattaacgatgtagagactggagaaatctcacagttactcagt
aaaggtagtttaggaaaatcatatgatgcagtattcccattattgcatggtccaaatgga
gaagatggaactatccaaggtctttttgaagtacttgatataccatatgtaggtaatggt
gtgttagctgcttcaagctcaatggataaacttgtgatgaaacaattatttgagcataga
ggtttacctcaattaccttatattagctttttaagaagtgagtatgaaaaatatgaaaat
aatatcattaaattagttaatgataagttaacatatccggtatttgtaaaacctgctaat
ctcggttcaagtgttggtataagtaaatgtaacaatgaagaagaattaaaatctgggata
actgaagcattccaatttgatcgtaaacttgtcattgaacaagggattaatgctagagag
atcgaagtagctgtcttaggtaacgattatcctgaaacgacatggcctggtgaggttgtt
aaggatgtagcgttttatgattataaatcaaagtataaagacggtaagattagattagat
attccagcagatttagatcaagatgttcaaatgacattaagaaacatggcattagaggcc
tttaaagctactgattgttcgggattagttcgtgcagatttctttgttactgatgataat
caaatttatatcaatgaaacaaatgccatgccaggatttactgcatatagtatgtatcca
aacttatggaaaaatatgggcttatcttaccctgatttaattgctaaattgattgatttg
gctaaagaacgttatgaagataaaaagaaaaataaatataaaattgattattag

DBGET integrated database retrieval system