KEGG   Staphylococcus epidermidis PM221: SEB_01731Help
Entry
SEB_01731         CDS       T03289                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sepp  Staphylococcus epidermidis PM221
Pathway
sepp00010  Glycolysis / Gluconeogenesis
sepp00071  Fatty acid degradation
sepp00280  Valine, leucine and isoleucine degradation
sepp00310  Lysine degradation
sepp00330  Arginine and proline metabolism
sepp00340  Histidine metabolism
sepp00380  Tryptophan metabolism
sepp00410  beta-Alanine metabolism
sepp00561  Glycerolipid metabolism
sepp00620  Pyruvate metabolism
sepp00625  Chloroalkane and chloroalkene degradation
sepp01100  Metabolic pathways
sepp01110  Biosynthesis of secondary metabolites
sepp01120  Microbial metabolism in diverse environments
sepp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sepp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SEB_01731
   00053 Ascorbate and aldarate metabolism
    SEB_01731
   00620 Pyruvate metabolism
    SEB_01731
  Lipid metabolism
   00071 Fatty acid degradation
    SEB_01731
   00561 Glycerolipid metabolism
    SEB_01731
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SEB_01731
   00310 Lysine degradation
    SEB_01731
   00330 Arginine and proline metabolism
    SEB_01731
   00340 Histidine metabolism
    SEB_01731
   00380 Tryptophan metabolism
    SEB_01731
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SEB_01731
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SEB_01731
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SEB_01731
Enzymes [BR:sepp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SEB_01731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh VASP_tetra Sec1
Motif
Other DBs
NCBI-ProteinID: CDM14269
LinkDB All DBs
Position
complement(1767831..1769258)
Genome map
AA seq 475 aa AA seqDB search
MRNFTKQYINGEWVDSASGETIDVINPATEEVMGKIAKGNEEDVNKAVDAADKVYLEFRH
SSVEERRELLDKIVKEYQNRKNDLIEAITDELGAPLSVSDNVHYQMGLNHFTAARDALDS
FQFEEQRGDDLVVKEAIGVAGLVTPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAI
ILAEIFDKVGVPKGVFNLVNGDGSGVGNPLSEHPKVRMMSFTGSGPTGSKIMEKAAKDFK
KVSLELGGKSPYIVLDDVDVEEAANATTKKVVNNTGQVCTAGTRVLIPESIKEDYLTAVK
EAFSKVKVGQPREEGTQVGPIISKKQFDQVQDYIDKGINEGAELFYGGPGKPEGLDKGYF
ARPTIFINVDNHMTIAQEEIFGPVMSVITYNNLDEAIEIANDTKYGLAGYVIGKDKDTLR
HVARSIEAGTIEINEAGRKPDLPFGGYKESGLGREWGDYGIEEFLEVKSIAGYFK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatttcactaaacaatatataaacggtgaatgggttgatagtgcaagcggtgaa
actattgatgttattaaccctgcaactgaagaagtaatgggtaaaattgctaaaggtaac
gaagaagatgttaataaagctgtagatgctgcagataaagtatatttagaatttagacat
agttctgttgaagaaagaagagaacttttagataaaatcgtaaaagaatatcaaaataga
aaaaatgatttaattgaagcaattactgatgaactaggagcgcctttatcagtttccgat
aacgttcattatcaaatgggattgaatcattttacagctgcaagagatgctttagatagc
ttccaatttgaagaacaacgtggcgatgatttggttgttaaagaagcaattggagttgct
ggacttgttacaccttggaatttccctacaaaccaaacttcacttaaattagctgctgcg
tttgctgctggtagccctgttgttttaaaaccatctgaagaaacaccatttgctgcaatt
attttagcagaaatttttgataaagtaggcgtacctaaaggtgtgtttaacttagtcaat
ggtgatggatctggagtaggaaatcctttaagtgaacatccaaaagtaagaatgatgtca
tttacaggttctggtcctacaggttcaaaaattatggaaaaagctgcaaaagacttcaaa
aaagtgtctcttgaattgggtgggaaatcaccttatatcgtattagatgacgttgatgtt
gaagaagctgctaatgcaacaacgaaaaaagtagttaacaatacaggtcaagtttgtact
gcaggaacacgtgtacttattcctgaaagtattaaagaagactacttaacagcagttaaa
gaagcatttagtaaagttaaagtaggtcaaccaagagaagaaggaactcaagtaggtcct
attattagtaaaaaacaatttgatcaagttcaggattacattgataaaggtatcaatgaa
ggagcagagttattctacggtggtccaggtaaaccagaaggattagataaaggatatttt
gcgcgtccaactatatttattaatgtagataatcacatgacgattgcacaagaagaaatt
ttcggacctgtcatgtctgtaatcacttataataatcttgacgaagctattgaaattgct
aatgatactaaatatggtcttgctggctatgttattggtaaagataaagatacattgaga
catgttgctcgttcaatcgaagctggtacaattgaaattaatgaagctggtagaaaacca
gacttaccattcggtggttataaagaatctggcttaggtcgtgaatggggcgattatggt
atcgaagaattcttagaagtaaaatcaatagctggatattttaaataa

DBGET integrated database retrieval system