KEGG   Serratia sp. ATCC 39006: Ser39006_012695Help
Entry
Ser39006_012695   CDS       T05290                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sera  Serratia sp. ATCC 39006
Pathway
sera00250  Alanine, aspartate and glutamate metabolism
sera00410  beta-Alanine metabolism
sera00640  Propanoate metabolism
sera00650  Butanoate metabolism
sera01100  Metabolic pathways
sera01120  Microbial metabolism in diverse environments
Module
sera_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sera00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Ser39006_012695
   00650 Butanoate metabolism
    Ser39006_012695
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ser39006_012695
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Ser39006_012695
Enzymes [BR:sera01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Ser39006_012695
Amino acid related enzymes [BR:sera01007]
 Aminotransferase (transaminase)
  Class III
   Ser39006_012695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase DUF1869
Motif
Other DBs
NCBI-ProteinID: AUH04914
UniProt: A0A2I5T7P4
LinkDB All DBs
Position
2815159..2816424
Genome map
AA seq 421 aa AA seqDB search
MNNSELNQRRLAATPRGVGVMCDFFAAKAENATLWDVEGHEYIDFSAGIAVLNTGHRHPK
ILAAVREQLECFTHTAYQVVPYGSYITLAERINAIAPIHGPAKTTFFTTGAEAVENAVKI
ARAYTKRPGVIAFNAAFHGRTLLTMTLTGKVAPYSTGFGPFPGSIFHAVYPSEHNGVTVE
QSLENIDRLLHTDIAADQVAAILLEPVQGEGGFNVAPPEFISALRKLCDEHGILLIADEV
QSGFARTGKVFAMEYYEEKADLITMAKSLGGGFPISGVVGRADVMDAPGPGGLGGTYAGN
PLAVASALAVLDVIEDEKLCQRAQQLGATLVETLRSLKAKCPAIVDIRARGSMVAVEFND
PQTGKPSAEITKTFQKEALNQGLLLLTCGVHGNVIRFLYPLTIPDAQFSKALDILTRVLT
Q
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaataatagcgaattaaatcaacgccgtttggccgccacgccgcgtggtgtaggggta
atgtgtgatttctttgctgccaaggcggagaatgccacgttgtgggatgtggaaggccat
gaatatattgatttttctgctgggattgcagtgctgaacactggccatcgccatccgaaa
attctggctgcagtgcgtgaacagctggagtgttttactcacaccgcttatcaggttgtg
ccttatggcagctatatcacgctggccgaacgtatcaatgcgatagcgcctatccacggg
ccggcaaaaaccactttcttcacgacgggtgctgaagctgttgaaaatgcagtgaaaatt
gcgcgtgcttataccaaacgccctggtgtgattgcctttaacgctgcttttcatggccgt
acattgctgaccatgacattgactggcaaagtggcaccttattccactggttttggccca
ttcccagggtccatttttcacgcggtatatcctagcgagcataatggcgtcacggtagaa
cagtcgctggaaaatatcgatcgtttgctgcataccgatattgctgctgatcaggtggcg
gctattctgctggaaccggtacagggtgaaggcggtttcaatgtggcgccaccggaattc
atcagcgcactgcgtaaactgtgtgatgagcacggcatattgttgattgccgatgaagta
caaagcggttttgcccgtactggcaaagtgtttgcgatggagtattacgaagaaaaagcg
gatctgatcaccatggcgaaaagcctggggggcggtttcccgatttccggcgtggttggt
cgcgctgacgtgatggatgccccaggaccgggcggactgggtggcacctatgctggtaac
cccctggcggtggcgtcagctctggcggtactggatgtgattgaagacgaaaaactgtgc
cagcgtgcgcagcaactgggagccacactggtagagacgctgagaagtctgaaagcgaag
tgcccggcgatcgtcgatattcgtgcccgtggctcaatggtggcggtagaattcaatgat
ccgcaaacgggtaaacctagtgcggagattaccaagacattccaaaaagaggcgctgaat
caggggctgctgctgctgacatgtggtgtgcatggcaacgtgatccgtttcctgtacccg
ctgaccattcctgatgctcagttcagtaaagcattggacatcctgacccgcgtcctgact
cagtaa

DBGET integrated database retrieval system