KEGG   Serratia sp. FS14: L085_21740Help
Entry
L085_21740        CDS       T03313                                 

Definition
(GenBank) D-alanine-D-alanine ligase A
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
serf  Serratia sp. FS14
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:serf00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    L085_21740
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    L085_21740
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    L085_21740
Enzymes [BR:serf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     L085_21740
Peptidoglycan biosynthesis and degradation proteins [BR:serf01011]
 Precursor biosynthesis
  Amino acid ligase
   L085_21740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(4715901..4717004)
Genome map
AA seq 367 aa AA seqDB search
MTKLRVGVIFGGKSAEHEVSLQSAKNIVDAIDKEKFDVTLLGIDKQGQWHINDASNYLLN
AENPALIALNRSNKNVALIPGQEKQQLIEAGSAGALGQLDVIFPIVHGTLGEDGSLQGLL
RMANMPFVGAGVLGSAVSMDKDVTKRLLRDAGLAVAPFVTLTRANRAGFTFEQLSERLGL
PLFVKPANQGSSVGVSKVENRAEFDAAVALAFSFDHKVLVESAIVGREIECAVLGNDDPQ
ASVCGEIVLSDAFYSYDTKYINEQGAQVVVPAAIASEVSDHIREVALKAFRALECFGLAR
VDVFLTPDNQVVINEINTLPGFTNISMYPKLWAASGVSYQALITRLIELALERHQQDRAL
NSSVFDR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
gtgactaaactacgtgttggggtgatttttggcggtaaatcggcggagcatgaggtgtcg
ctgcagtcggccaaaaacattgtggatgcaatcgacaaagagaagtttgacgtcacgctg
ctggggatcgacaaacaggggcagtggcacatcaacgacgcctccaactatctgctcaat
gccgagaacccggcgctgatcgcgctgaaccgctcgaacaagaacgtggcgctgatcccg
ggccaggaaaagcagcagctgatcgaagcgggcagcgccggcgcgctggggcagctcgac
gtcatcttcccgatcgtgcacggcacgctgggagaggacggctcgctgcaggggttgctg
cgcatggccaatatgccgttcgtcggcgccggggtgctcggctcggcggtcagcatggat
aaagacgtgaccaaacgcctgctgcgcgacgccgggctggcggtggcgccgttcgtcacc
ctgacgcgcgccaaccgtgccgggttcacgtttgagcaactgagcgagcgcctcggcctg
ccgctgttcgtcaagccggccaaccagggctcgtcggtcggggtcagcaaggtggaaaac
cgcgccgagtttgacgcggcggtggcgctggccttcagtttcgatcacaaagtgctggtg
gagtcggcgatcgtcggccgcgagatcgagtgcgcggtgctgggcaacgacgatccgcag
gccagcgtgtgcggcgagatcgtgctgagcgacgctttctactcctacgacaccaaatac
atcaatgagcagggcgctcaggtggtggtgccggcggcgatcgcgtcggaagtgagcgac
cacatccgtgaggtggcgctgaaggcgttccgcgcgctggagtgcttcgggttggcgcgg
gtggatgtgttcctgacgccggacaaccaggtggtaatcaacgaaatcaacacgctgccg
ggcttcaccaacatcagcatgtatcccaagctgtgggctgccagcggcgtcagctaccag
gcgctgatcacgcgcctgatcgaattggcgctggagcgccaccagcaggatcgcgcgctg
aacagctcggtgttcgatcgctaa

DBGET integrated database retrieval system