KEGG   Salmonella enterica subsp. enterica serovar Typhimurium var. 5- CFSAN001921: CFSAN001921_10980Help
Entry
CFSAN001921_10980 CDS       T02737                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
setc  Salmonella enterica subsp. enterica serovar Typhimurium var. 5- CFSAN001921
Pathway
setc00020  Citrate cycle (TCA cycle)
setc00480  Glutathione metabolism
setc01100  Metabolic pathways
setc01110  Biosynthesis of secondary metabolites
setc01120  Microbial metabolism in diverse environments
setc01130  Biosynthesis of antibiotics
setc01200  Carbon metabolism
setc01210  2-Oxocarboxylic acid metabolism
setc01230  Biosynthesis of amino acids
Module
setc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
setc_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:setc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CFSAN001921_10980
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CFSAN001921_10980
Enzymes [BR:setc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CFSAN001921_10980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AGQ68166
LinkDB All DBs
Position
complement(2239434..2240684)
Genome map
AA seq 416 aa AA seqDB search
MESKVVVPVEGKKITLQNGKLNVPENPIIPFIEGDGIGVDVTPAMLKVVDAAVEKAYKGE
RKISWMEIYTGEKSTQVYGQDVWLPAETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALRQ
ELDLYVCLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADSADAEKVIKFLR
EEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAITNDRDSVTLVHKGNIMKFTEGA
FKDWGYQLARDEFGGELIDGGPWLKIKNPNTGKEIVVKDVIADAFLQQILLRPAEYDVIA
CMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSA
EMMLRHMQWFEAADLIVKGMEGAIAAKTVTYDFERLMEGAKLLKCSEFGDAIIANM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggtggaaggtaagaagatcaccctgcaaaacggcaaa
ctcaacgttcctgagaatccgattatcccgtttattgaaggcgatggtatcggtgttgat
gtcactccagccatgcttaaagtagtcgatgccgccgtcgagaaagcctataaaggcgag
cgtaaaatttcctggatggaaatttacaccggagaaaaatccacacaggtttacggccag
gatgtctggcttcccgctgaaacccttgatttaattcgtgactaccgcgtagcgattaaa
ggtccattgaccacgccggttggcggcggtatccgctctctgaacgttgccctgcgtcag
gagcttgacctgtacgtttgtctgcgtcccgttcgttactatcagggcacgccaagtccg
gtgaaacatccggagctgaccgatatggtcatcttccgtgaaaactctgaagacatctac
gccggaattgaatggaaagctgactctgcagacgctgagaaagtgatcaagttcctgcgc
gaagagatgggcgtgaagaaaattcgcttcccggagcactgcggtatcggtatcaaaccg
tgttctgaagaaggcactaaacgtctggttcgcgcggcgattgaatacgctattaccaac
gatcgcgattccgtcacgctggtacataaaggcaatatcatgaagttcaccgaaggcgcg
tttaaagactggggctaccagttggcgcgcgacgagttcggcggtgagcttattgacggc
ggtccgtggctgaaaattaagaacccgaacacgggtaaagagatcgtggttaaagacgtt
atcgccgatgcgttcctgcaacaaatcctgttgcgtccggcggaatacgacgttatcgcc
tgtatgaacctgaacggtgactatatttccgatgccctggcggctcaggttggcggtatc
ggtattgcaccgggtgcgaatatcggcgacgaatgcgcgttgtttgaagcgactcacggg
actgcgccgaaatatgcgggccaggataaagtcaacccaggctccattattctgtctgcg
gagatgatgctgcgccacatgcagtggttcgaagccgcagacctgattgttaaaggtatg
gaaggcgcgattgccgcgaagaccgtgacctatgactttgaacgcctgatggaaggcgct
aagctgctgaaatgtagtgagtttggtgacgcgattatcgcgaatatgtaa

DBGET integrated database retrieval system