KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A3862Help
Entry
SeSA_A3862        CDS       T00743                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sew00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SeSA_A3862
Enzymes [BR:sew01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SeSA_A3862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3728725..3730752
Genome map
AA seq 675 aa AA seqDB search
MKLAAFALTLIPGIAIASSWTSPGFPTFSTQETGRFTSHAALTKGTRALTLHIDQQCWQP
SGAIKLNQMLSLKPCEGAPPQWRLFKDGDYTITVDTRSGTPTLLLSIKTEPERTTQLTYQ
CPVWDGSPLTLDVSQTFPEGTVVRDYYSGQTDTVQNGQITLQPADSHGLLLLERAETHAS
APFNWRNATVYFVLTDRFRNGDPTNDHSYGRHKDGMQEIGTFHGGDLRGLTSQLDYLQQL
GVNALWISSPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTTLDANMGSEADLRALVDGAH
QRGIRILFDVVMNHAGYATLADMQEYQFGALYLSGAERQKILGDRWTNWRPAAGQSWHSF
NDYINFSDSAAWEKWWGKKWIRTDIGDYDSPGFDDLTLSLAFLPDIKTESTTPSGLPAFY
ANKPDTKAKFIEGYTPRDYLTHWLSQWVHDYGIDGFRVDTAKNVELPAWQQLKTQASAAL
REWKQANPDKALDDSPFWMTGEAWGHGVMKSDYYRYGFDAMINFDYQEQAAKAVDCLAEM
GPVWQQMADKMQDFNVLSYLSSHDTRLFREGGDKAAELLLLSPGAVQIFYGDESARPFGP
TGSDPLQGTRSDMNWQDVSGKSAAAVAHWQRISQFRARHPAIGAGQQTTLTLKHGYGFVR
QYGDDTVMVVWAGRR
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgccgccttcgctctgacgctgatacccggtatcgcgatcgcctcatcatgg
acctcgcccggttttccgacgttctcgacgcaggaaaccggacgctttaccagccatgct
gcattaacaaaaggtacacgcgcgttaacgctccatattgaccagcagtgctggcagccc
tccggcgccataaaactcaaccagatgttgtcgttaaaaccctgcgaaggcgcgccgccg
caatggcgtttgtttaaagatggcgactatacaataacggtagatacccgctccggtacg
ccgaccctgttgttatcgataaaaactgaacctgaacgcaccacacagctcacctaccag
tgtcccgtctgggatggttcgccgctcacgctggatgttagccagacctttccggaaggg
acggtagtgcgcgattattacagtggtcaaaccgataccgtccaaaacgggcaaatcacg
ctgcaacctgccgacagccacgggcttttattgctggaacgcgcggaaacccatgcatca
gcgccttttaactggcgcaacgccaccgtttattttgtgcttacggatcgctttcgcaat
ggcgatccaaccaacgaccacagctatggtcgccataaggatggtatgcaagagattggc
actttccacggcggcgatttgcgcgggttgacgagtcaactggactatctacagcaatta
ggcgtgaacgccttgtggataagctcgccgtttgaacagatccacggctgggtcggcggc
gggacaaaaggcgattttcctcattacgcctatcacggctattacactcaggactggacg
acgctggatgccaatatgggcagcgaagccgatctccgcgcgctggtcgacggcgcgcac
cagcgcggcatccgtattttatttgacgtagtaatgaatcatgccggttacgccacgctg
gcggatatgcaggagtatcagttcggcgcgctctatttatccggcgcggaacggcaaaaa
attctcggcgatcgctggacaaactggcgacccgccgccggacaaagctggcacagcttt
aacgactacatcaacttcagcgacagcgccgcctgggaaaaatggtgggggaaaaagtgg
attcgtaccgatattggcgactacgacagtccgggatttgacgatttaaccctgtcgctg
gcctttctgccggatataaaaacggaatctaccacgccttccggcctacccgcgttctat
gccaacaaacccgatactaaagcaaagttcattgaaggctatacgccacgggattatctg
actcactggttaagccagtgggtgcatgattacggcattgacgggttccgggtcgatact
gccaaaaatgttgagcttcctgcctggcaacagctaaaaacccaggccagcgcggcatta
cgcgagtggaagcaggccaatccggacaaagcgctggatgatagcccgttctggatgact
ggcgaagcgtggggccacggcgtcatgaaaagtgactattatcgctatggtttcgacgcg
atgatcaattttgattatcaggagcaggccgcgaaagcggtcgattgcctggcggaaatg
gggccagtctggcagcagatggcggataaaatgcaggatttcaacgtattaagttacctc
tcctcgcatgatacgcgccttttccgtgagggcggtgataaggcggcggaactgctgctg
ctttcgccgggcgcggtgcagatcttttacggcgatgaatccgctcgtcccttcggcccc
accggctccgaccccctgcaaggcacccgttcagatatgaactggcaggacgtgagcgga
aagtcagccgcagccgtcgcgcactggcagcgtattagccagttccgcgccagacatccc
gccatcggcgcaggccaacaaaccacgctgacgctaaaacacgggtacggttttgtacgc
cagtacggcgacgatacggtgatggtcgtctgggcaggccgccgctaa

DBGET integrated database retrieval system