KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_2318Help
Entry
SL1344_2318       CDS       T01724                                 

Gene name
yfcG
Definition
(GenBank) hypothetical glutathione-S transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Brite
Enzymes [BR:sey01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     SL1344_2318 (yfcG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2458129..2458776
Genome map
AA seq 215 aa AA seqDB search
MIDLYYAPTPNGHKITLFLEEAELAYRLLKVDISKGNQFRPDFLAISPNNKIPAIVDHAP
ADGGQPLSLFESGEILLYLAEKSGKLLSGELRERHTTLQWLFWQVGGLGPMLGQNHHFNH
FAPQAIPYAIERYQVETQRLYNVLNKRLETSPWLGGDHYSIADIASWPWVNAHQRQRIDL
DTYPAVYNWFERIRTRPATARALLQAQLHCNSTKA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgattgacctttactacgcccccacgcccaacgggcataaaataacgctgtttctggaa
gaggcggagctggcgtatcgtttgctaaaagtagatatcagcaagggcaatcagtttcgc
cctgattttttggctatctctcccaataataaaattcctgccatcgtcgatcacgccccg
gcagacggcggtcaaccgcttagtctttttgaatccggcgaaattcttctctacctggcg
gaaaaaagcggcaaactgcttagcggggagctgcgtgaacgccataccacgctgcaatgg
ctgttctggcaggtcggcgggttagggccgatgctgggccagaatcatcactttaaccac
tttgcgccgcaggccatcccctatgcaattgaacgctatcaggttgaaacgcaacgctta
tacaacgtcctgaataaacgcctggaaacctccccgtggctgggcggcgaccactacagt
attgcggatatcgccagttggccgtgggttaacgcacatcagcgtcagcgaatcgatctt
gatacctacccggcggtgtataactggtttgaacgcattcgcacgcgtcctgcgacagcg
cgcgcactgttacaagcgcaactgcactgtaacagtacgaaagcgtaa

DBGET integrated database retrieval system