KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_2776Help
Entry
SL1344_2776       CDS       T01724                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Pathway
sey00250  Alanine, aspartate and glutamate metabolism
sey00280  Valine, leucine and isoleucine degradation
sey00410  beta-Alanine metabolism
sey00640  Propanoate metabolism
sey00650  Butanoate metabolism
sey01100  Metabolic pathways
sey01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sey00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SL1344_2776 (gabT)
   00650 Butanoate metabolism
    SL1344_2776 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SL1344_2776 (gabT)
   00280 Valine, leucine and isoleucine degradation
    SL1344_2776 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SL1344_2776 (gabT)
Enzymes [BR:sey01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SL1344_2776 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     SL1344_2776 (gabT)
Amino acid related enzymes [BR:sey01007]
 Aminotransferase (transaminase)
  Class III
   SL1344_2776 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CBW18874
UniProt: A0A0H3NF14
LinkDB All DBs
Position
2964173..2965456
Genome map
AA seq 427 aa AA seqDB search
MNTNNALMQRRHNAVPRGVGQIHPIFAERAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
GIVSAVEAQLKKLSHTCFQVLAYEPYLALCERMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGAIAFSGAYHGRTHYTLSLTGKVHPYSAGMGLMPGHVYRALYPCPLHNISD
DDAIASIERIFKNDAAPEDIAAIIIEPVQGEGGFYAASPAFMQRLRALCDQHGIMLIADE
VQSGAGRTGTLFAMEQMGVAADITTFAKSIAGGFPLAGVTGRADVMDAIAPGGLGGTYAG
NPIACAAALAVLDIFEQENLLQKANTLGKTLRDGLMEIAETHREIGDVRGLGAMIAIELF
ENGDPGKPNAALTADIVTRAREKGLILLSCGPYYNILRILVPLTIEASQIRQGLEIIAQC
FDEAKQA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaataccaataacgctttaatgcagcgccgtcataacgccgttcctcgcggcgtgggg
cagattcacccgattttcgccgagcgggcggaaaattgtcgggtgtgggatgtcgaaggc
cgtgagtatctcgatttcgcgggcggcattgccgtcctgaacaccggtcatttacatccg
ggcattgtttcagcggtcgaagcgcagttgaagaaattgtcccatacctgttttcaggtg
ctggcctatgaaccgtatctggcgttgtgcgaacgcatgaaccagaaggtaccgggcgat
ttcgccaaaaaaacgttgctggtcacgaccggttcagaagcggttgaaaacgcggtgaaa
atcgcccgcgcggcgacaaaacgcagcggcgctatcgcgtttagcggcgcttaccacggt
cgtacccactacacgctctctctgaccgggaaagtacacccgtactctgctggtatggga
ttgatgccaggccatgtctaccgcgcgctttatccttgcccgctacacaacatcagcgac
gacgacgcgatcgccagcattgaacgcatctttaaaaatgatgccgcgccggaagatatc
gccgccattattattgagccggtacagggcgaaggcggattttacgccgcctctcccgcg
tttatgcagcgactgcgcgcgctatgcgaccaacacggcattatgttgattgccgacgaa
gtgcaaagcggcgcgggccggaccggtacgctgttcgccatggaacagatgggcgttgcg
gcagatattaccacgtttgcgaaatcgatcgccggcggctttccgctggcaggcgttacc
ggccgggcagacgtgatggacgctatcgcgccgggcgggctgggcggcacctatgccgga
aacccgattgcctgcgccgccgcgctggcggtactggacattttcgagcaggaaaatcta
ctgcaaaaggcgaatacgcttggcaaaacgctgcgcgatggcctgatggagatagcggaa
acgcaccgtgagattggcgacgtgcgcggactgggcgccatgatcgccattgagttgttc
gaaaatggcgaccccggcaaaccgaacgcggctctgaccgccgacattgtgacccgcgcc
cgcgagaaagggttaattctgctctcctgcggtccttactacaacatcttgcgcatcctc
gttccactcactattgaggcctcgcagattcggcaaggcctggagattatcgcccagtgc
tttgatgaggcgaaacaagcgtaa

DBGET integrated database retrieval system