KEGG   Streptomyces pratensis: Sfla_0697Help
Entry
Sfla_0697         CDS       T01647                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
sfa  Streptomyces pratensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
811640..812725
Genome map
AA seq 361 aa AA seqDB search
MRWVRIGTMDLPVMPPVKPMLAKSVSAIPPGMQYEAKWDGFRAIVHRDGDEVVIGSRTGK
PLTRYFPEVVTAVLENLPRRCVIDGEIVLPYDGRLDFDRLSERIHPADSRVRTLAERTPA
SFVAFDVLALDDTSLLAAPQTERRRILEEALAEASAPVHLAPSTTDPALAREWFERYEGA
GLDGVVAKPLDLPYRPDARVMYKIKHERTADCVVAGYRFHKSGPVVGSLLLGLYDSGGAL
QHVGVCAAFSMKRRAELVEELDPLRIEPAEHPWAAWADAAAHEGSRLPGAPSRWSGKKDL
SWVALAPERVCEVAYDHMEGDRFRHTTQFRRWRPDRTPSGCTYAQLEEVVRYDLAEVLST
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgcggtgggtgagaatcgggaccatggacctgccggtgatgcctcccgtgaagccgatg
ctcgccaagtccgtgtccgcgattccccccgggatgcagtacgaggcgaagtgggacggg
ttccgggcgatcgtgcaccgtgacggcgacgaggtggtgatcggcagccggacgggcaag
cccctgacccgctacttccccgaggtggtcaccgccgtgctggagaaccttccccggcgc
tgtgtgatcgacggtgagatcgtcctgccgtacgacgggcggctggacttcgaccggctg
agcgagcgcatccatccggccgactcccgggtccggacgctcgccgaacggaccccggcg
agcttcgtcgccttcgatgtcctcgccctggacgacacgtccctgctggccgcaccgcag
accgagcggcgcaggatcctggaggaggcgctggcggaggcctcggcgcccgtccatctc
gccccctccaccacggatccggccctcgcgcgggagtggttcgagcggtacgagggggcg
gggctcgacggagtggtcgccaaaccgctcgatctgccgtaccggccggacgcccgcgtc
atgtacaagatcaagcacgaacggaccgcggactgcgtggtggcgggctaccgcttccac
aagagcggccccgtggtgggctcgctgctgctcgggctgtacgactccgggggcgccctg
cagcacgtgggggtgtgcgccgccttctcgatgaagcggcgcgccgaactggtcgaggag
ctggatccgttgcgcatcgagccggcggaacatccgtgggccgcctgggcggacgcggcg
gcgcacgagggttcacggctgccgggcgctccgagccgctggtcgggcaagaaggacctg
tcctgggtggcgctcgcgcccgagcgggtctgcgaggtggcgtacgaccacatggagggt
gaccgcttccgccacaccacccagttccgccggtggcggccggatcgcaccccctccggc
tgcacgtacgcgcagctggaggaagtggtgcgctacgacctggccgaggtgctgagcacc
cgctga

DBGET integrated database retrieval system