KEGG   Streptomyces pratensis: Sfla_0943Help
Entry
Sfla_0943         CDS       T01647                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00020  Citrate cycle (TCA cycle)
sfa00480  Glutathione metabolism
sfa01100  Metabolic pathways
sfa01110  Biosynthesis of secondary metabolites
sfa01120  Microbial metabolism in diverse environments
sfa01130  Biosynthesis of antibiotics
sfa01200  Carbon metabolism
sfa01210  2-Oxocarboxylic acid metabolism
sfa01230  Biosynthesis of amino acids
Module
sfa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sfa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sfla_0943
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Sfla_0943
Enzymes [BR:sfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Sfla_0943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ADW02399
UniProt: E8WEJ9
LinkDB All DBs
Position
complement(1085388..1087607)
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVIEAYASTAGVTVERRDISLAGRIIAGFPERLEAGQ
RIDDALAELGELARTPGANIIKLPNISASIPQLKAAIAELQAQGYALPDYPDDPRTDEDK
DVRARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKAHPHRMGAWSADSKTNVATMGVDD
FRSTEKSVVIGEAGSLRIELAGDDGTTTVLRESVPVLAGEVVDAAVMRVAALREFFTAQV
ARAKAEDVLFSVHLKATMMKVSDPIIFGHVVRAFFPNTFAKYGDVLAAAGLTPNDGLGGI
LKGLDSVDAGAEIKASFEAELAEGPALAMVDSDKGITNLHVPSDVIVDASMPAMIRTSGH
MWGPDGNEADTIAVLPDSSYAGVYQVVIDDCRANGAFDPSTMGSVPNVGLMAQKAEEYGS
HDKTFEVPTTGTVRVVDGKGDVLLEQAVGAGDIFRMCQTKDLPIQDWVKLAVTRARATGN
PAVFWLDEGRAHDANLIAKVNTYLAEHDTDGLDISIRTPEEATAFSLERIRRGEDTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMNGGGLFETGAGGSAPKHVQQLVKEDYLRWD
SLGEFLALAVSFEHLATTTGNARARVLGDTLDRATGTFLNEDKSPSRKLGGIDNRGSHFY
LALYWAQELARQTDDAALAEAFGPLAKTLSEQERTIVDELIAVQGKPADIGGYYQPDPAK
AEAVMRPSATFNKAIATLG
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctatacgcacaccgacgaggcccctgccctggcgacgtac
tcgttcctgcccgtcatcgaggcctacgcctcgaccgcgggtgtcacggtggaacgccgc
gacatctccctggcgggacggatcatcgccggcttcccggagcgtctcgaggccggccag
cgtatcgatgacgcgctcgccgagctcggcgagctggccaggactcccggcgcgaacatc
atcaagctgcccaacatctctgcctcgatcccgcagctgaaggccgcgatcgcagagctc
caggcgcagggctacgcgcttccggactacccggacgacccgcggaccgacgaggacaag
gacgtccgcgcgcggtacgacaaggtcaagggcagtgcggtcaaccccgtcctgcgtgag
ggcaactccgaccgccgcgcccccgcctcggtcaagaactacgccaaggcccacccgcac
cgcatgggtgcctggagcgccgactcgaagacgaacgtcgccaccatgggcgtcgacgac
ttccgctcgacggagaagtccgtcgtgatcggtgaggccggttcgctgcgcatcgagctc
gcgggcgacgacggcaccaccaccgtgctgcgcgagtccgtacccgtcctcgcgggcgag
gtcgtggacgccgccgtcatgcgggtcgccgcgctgcgtgagttcttcaccgcccaggtc
gcgcgcgccaaggccgaggacgtcctgttctccgtgcacctgaaggccacgatgatgaag
gtctccgacccgatcatcttcggccacgtcgtccgcgccttcttcccgaacacgttcgcc
aagtacggcgacgtcctcgcggcggccggcctgaccccgaacgacggcctcggcggcatc
ctcaagggcctcgactccgtggacgccggcgccgagatcaaggcgtccttcgaggccgag
ctcgccgagggccccgccctggcgatggtcgactccgacaagggcatcaccaacctgcac
gtgccgagcgacgtcatcgtcgacgcgtccatgccggcgatgatccgcacctccggccac
atgtggggcccggacggcaacgaggccgacaccatcgcggtcctccccgacagcagctac
gccggtgtctaccaggtcgtcatcgacgactgccgcgccaacggcgccttcgacccgtcg
accatgggctccgtgcccaacgtcggtctgatggcgcagaaggccgaggagtacggcagc
cacgacaagaccttcgaggtccccaccaccggcacggtgcgggtcgtcgacggcaagggc
gacgtcctcctggagcaggccgtcggtgccggtgacatcttccgcatgtgccagaccaag
gacctgccgatccaggactgggtcaagctcgccgtcacgcgcgcccgcgcgaccggcaac
ccggccgtgttctggctcgacgagggccgtgcccacgacgccaacctcatcgccaaggtc
aacacctacctggccgagcacgacaccgacggcctggacatctccatccgcacgccggag
gaggccacggcgttctccctggagcgcatccgccgcggtgaggacaccatctcggtcacc
ggcaacgtgctgcgtgactacctcaccgacctgttcccgatcctcgagctgggcaccagc
gcgaagatgctctccgtcgtcccgctgatgaacggcggcggactgttcgagaccggcgcc
ggcggctccgcgcccaagcacgtccagcagctggtcaaggaggactacctgcgctgggac
agcctgggcgagttcctcgcgctcgcggtcagcttcgagcacctcgcgaccaccacgggc
aacgcgcgcgcccgggtgctcggtgacaccctggaccgggcgaccggcaccttcctcaac
gaggacaagtccccgagccgcaagctcggcggcatcgacaaccgcggcagccacttctac
ctggcgctctactgggcccaggagctggcgcggcagaccgacgacgccgcgctcgccgag
gcgttcgggccgctcgccaagacgctgtccgagcaggagcggaccatcgtcgacgagctg
atcgccgtccagggcaagccggccgacatcggcggctactaccagcccgacccggcgaag
gcggaggccgtcatgcgtccgtcggccaccttcaacaaggccatcgcgaccctgggctga

DBGET integrated database retrieval system