KEGG   Streptomyces pratensis: Sfla_2013Help
Entry
Sfla_2013         CDS       T01647                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 subunit
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
sfa  Streptomyces pratensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sfla_2013
  Amino acid metabolism
   00310 Lysine degradation
    Sfla_2013
   00380 Tryptophan metabolism
    Sfla_2013
Enzymes [BR:sfa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     Sfla_2013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2447195..2451046
Genome map
AA seq 1283 aa AA seqDB search
MISAVHHLVKRKRAVAAVSSQSPSNSSISTDQEAGSGSNPAAAFGPNEWLVDEIYQQYLQ
DPNSVDRAWWDFFADYKPGTSGTADKPVPAPTGAVTPAPAATNGATAQAPAAPPAAPAAP
AAAAPAAPAAPAKAAPAAPAKAAPAKAAPAAAKADASTEAPAGPEYVTLRGPSAAVAKNM
NASLELPTATSVRAVPVKLLFDNRIVINNHLKRARGGKISFTHLIGYAMVQALKAMPSMN
YSFAVKDGKPTLVKPEHVNLGLAIDLVKPNGDRQLVVAAIKKAETLNFFEFWQAYEDIVR
RARVGKLGMDDFSGVTASLTNPGGIGTVHSVPRLMPGQGLIMGVGAMDYPAEFQGTSQDT
LNKLGISKVMTLTSTYDHRVIQGAASGEFLRVLAQLLLGENDFYDEIFKALRIPYEPVRW
LKDIDASHDDDVTKAARVFELIHSYRVRGHVMADTDPLEYRQRKHPDLDITEHGLTLWDL
ERDFAVGGFAGKTMMKLRDILGVLRESYCRTTGIEFMHIQEPKERKWLQDRVERPRPAPE
REEQLRILRRLNAAEAFETFLQTKYVGQKRFSLEGGESVIPLLDAVIDSAAEARLDEVVI
GMAHRGRLNVLANIVGKSYAQIFREFEGNLDPRSMHGSGDVKYHLGAEGTFTGLDGEQIK
VSLAANPSHLEAVDPVLEGIARAKQDIINKGGTDFTVLPVALHGDAAFAGQGVVAETLNM
SQLRGYRTGGTVHVVINNQVGFTAAPESSRSSMYATDVARMIEAPIIHVNGDDPEAVVRV
ARLAFEYRQTFNKDVVIDLICYRRRGHNEGDNPEFTNPQMYTLIDKKRSVRKLYTESLIG
RGDITLEEAEQALQDFQGQLEKVFAEVREATSAPSQPHVPDVQAEFPVSVGTAVSSEVVK
LIAESQVNIPDGITVHPRLLPQMQRRAASVDNGTIDWGMGETLAIGSLLMEGTPVRLAGQ
DTRRGTFGQRHAVLVDQKTGEDYTPLLYLSEDQARYNVYDSLLSEYAAMGFEYGYSLARP
ESLVIWEAQFGDFVNGAQTVVDEFISSAEQKWGQTSGVTLLLPHGYEGQGPDHSSARPER
FLQMCAQDNMTVAMPTLPSNYFHLLRWQVHNPHHKPLIVFTPKSMLRLKAAASKVEEFTT
GGFRPVIGDETVGAEAVRKVVFVSGKLYYDLDAEREKRGDTETAIIRLERLYPLPGAEIQ
AEIAKYPNAEKYLWAQEEPANQGAWPFIALNLIDHLDLAVGADVPHGERLRRISRPHGSS
PAVGSAKRHQAEQTQLVNEVFEA
NT seq 3852 nt NT seq  +upstreamnt  +downstreamnt
ttgatttccgctgtccatcaccttgtgaagcggaagagggcggttgccgccgtgtcgtct
cagtcccccagtaactcgagcatctcgaccgatcaagaagcgggctccgggtccaacccg
gccgccgctttcggccccaatgagtggctcgtcgacgagatctaccagcagtacctccag
gaccccaactcggtcgaccgcgcctggtgggacttcttcgccgactacaagccgggtacg
tccggcacggcggacaagcccgtccccgcacccacgggagcggtgaccccggccccggcc
gcgaccaacggcgccacggcacaggctccggccgcgccgccggcggccccggccgcaccc
gcggccgccgctccggcggctccggccgccccggcgaaggccgctcccgccgctcccgcc
aaggcggcacccgcgaaggcggccccggccgccgcgaaggctgacgcctcgaccgaggcc
ccggccggccccgagtacgtgacgctgcgcggcccgtcggccgccgtcgcgaagaacatg
aacgcctccctggagctgccgacggccacgtcggtccgcgccgtgccggtgaagctgctc
ttcgacaaccgcatcgtcatcaacaaccacctgaagcgggcccgtggcgggaagatctcc
ttcacgcacctcatcgggtacgcgatggtgcaggccctcaaggccatgccgtcgatgaac
tactccttcgcggtgaaggacggcaagccgaccctggtcaagccggagcacgtgaacctc
ggcctcgccatcgacctggtgaagccgaacggcgaccgtcagctcgtcgtcgcggccatc
aagaaggccgagaccctcaacttcttcgagttctggcaggcctacgaggacatcgtccgc
cgtgcccgcgtcggcaagctcggcatggacgacttctccggggtcaccgcctcgctgacg
aaccccggcggcatcggcaccgtgcactcggtgccccgcctgatgcccggacagggcctc
atcatgggtgtcggcgccatggactaccccgcggagttccagggcacctcccaggacacc
ctgaacaagctgggtatctcgaaggtcatgaccctgacctcgacgtacgaccaccgggtc
atccagggtgccgcgtccggcgagttcctccgcgtcctggcccagctgctgctcggcgag
aacgacttctacgacgagatcttcaaggcgctgcgcatcccctacgagccggtccgctgg
ctcaaggacatcgacgcctcgcacgacgacgacgtcaccaaggccgcgcgggtcttcgag
ctgatccactcctaccgggtccgcggtcacgtgatggccgacaccgacccgctggagtac
cgccagcgcaagcaccccgacctggacatcaccgagcacggcctcaccctgtgggacctg
gagcgcgacttcgcggtcggcggtttcgccggcaagacgatgatgaagctgcgcgacatc
ctcggcgtcctgcgtgagtcgtactgccgcaccaccggcatcgagttcatgcacatccag
gagccgaaggagcgcaagtggctccaggaccgggtggagcgtccgcgccccgctccggag
cgcgaggagcagctgcggatcctgcgccgcctcaacgccgccgaggcgttcgagacgttc
ctgcagaccaagtacgtcggccagaagcgcttctcgctggagggcggcgagtccgtcatc
ccgctgctcgacgcggtcatcgactccgccgccgaggcccgcctcgacgaggtcgtcatc
ggcatggcccaccgcggccggctgaacgtcctggcgaacatcgtgggcaagtcgtacgca
cagatcttccgggagttcgagggcaacctcgacccgcggtcgatgcacggctccggcgac
gtcaagtaccacctgggcgccgagggcaccttcaccggtctggacggcgagcagatcaag
gtctcgctggccgccaacccctcgcacctggaggccgtcgacccggtcctcgagggcatc
gcgcgcgccaagcaggacatcatcaacaagggcggcacggacttcacggtcctgcccgtc
gcgctccacggcgacgcggccttcgcgggccagggcgtcgtcgccgagacgctcaacatg
tcgcagctgcgcggctaccgcaccggcggcaccgtgcacgtggtgatcaacaaccaggtc
ggcttcaccgccgccccggagtcctcacgctcctcgatgtacgccacggacgtggcgcgc
atgatcgaggcgccgatcatccacgtcaacggcgacgacccggaggccgtggtgcgcgtc
gcgcggctcgccttcgagtaccggcagacgttcaacaaggacgtcgtgatcgacctcatc
tgctaccgccgccgcggtcacaacgagggcgacaacccggagttcaccaacccgcagatg
tacaccctgatcgacaagaagcgctcggtgcgcaagctctacaccgagtccctcatcggt
cgtggcgacatcacgctggaagaggccgagcaggcgctccaggacttccaggggcagctg
gagaaggtcttcgccgaggtccgcgaggccacctccgcgccgtcccagccgcacgtcccg
gacgtccaggcggagttcccggtctcggtcggcaccgcggtgtcctccgaggtcgtgaag
ctgatcgccgagtcgcaggtcaacatccccgacggcatcacggtgcacccgcgtctgctg
ccgcagatgcagcgccgcgcggcctcggtggacaacggcacgatcgactggggcatgggc
gagaccctggccatcggttcgctgctgatggagggcaccccggtccggctcgccggccag
gacacccgccgcggcacgttcggtcagcgtcacgccgtcctcgtcgaccagaagaccggc
gaggactacaccccgctgctctacctctccgaggaccaggcccgttacaacgtctacgac
tcgctgctcagcgagtacgcggcgatgggcttcgagtacggctactcgctggcccgcccg
gagtccctggtgatctgggaggcccagttcggtgacttcgtcaacggcgcccagaccgtc
gtggacgagttcatctcctccgccgagcagaagtggggccagacgtccggcgtcaccctg
ctgctcccgcacggctacgagggccagggcccggaccactcgtccgcgcgcccggagcgc
ttcctgcagatgtgcgcgcaggacaacatgacggtcgcgatgcctaccctcccgtcgaac
tacttccaccttctgcgctggcaggtgcacaacccgcaccacaagccgctgatcgtcttc
accccgaagtcgatgctgcgtctcaaggccgccgcctcgaaggtcgaggagttcaccacc
ggcggcttccgcccggtgatcggcgacgagacggtcggcgccgaggcggtccgcaaggtc
gtgttcgtgtccgggaagctctactacgacctggacgccgagcgcgagaagcgcggcgac
acggagacggcgatcatccggctggagcgtctgtacccgctgccgggtgcggagatccag
gccgagatcgccaagtacccgaacgccgagaagtacctctgggcccaggaggagccggcg
aaccagggtgcgtggccgttcatcgcgctcaacctgatcgaccacctggacctggccgtc
ggcgccgacgtgccgcacggtgagcgcctgcgccgcatctcgcgtccgcacggctcgtcc
ccggcggtcggctcggccaagcgtcaccaggccgagcagacccagctggtcaacgaggtc
ttcgaggcctga

DBGET integrated database retrieval system