KEGG   Sinorhizobium fredii USDA 257: USDA257_c18040Help
Entry
USDA257_c18040    CDS       T02188                                 

Gene name
acoC2
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd00010  Glycolysis / Gluconeogenesis
sfd00020  Citrate cycle (TCA cycle)
sfd00620  Pyruvate metabolism
sfd01100  Metabolic pathways
sfd01110  Biosynthesis of secondary metabolites
sfd01120  Microbial metabolism in diverse environments
sfd01130  Biosynthesis of antibiotics
sfd01200  Carbon metabolism
Module
sfd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    USDA257_c18040 (acoC2)
   00020 Citrate cycle (TCA cycle)
    USDA257_c18040 (acoC2)
   00620 Pyruvate metabolism
    USDA257_c18040 (acoC2)
Enzymes [BR:sfd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     USDA257_c18040 (acoC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Biotin_lipoyl Hydrolase_4 Thioesterase Ser_hydrolase Biotin_lipoyl_2 HlyD_3 RnfC_N DUF1057
Motif
Other DBs
NCBI-ProteinID: AFL50391
UniProt: I3X3D5
LinkDB All DBs
Position
complement(1903528..1904655)
Genome map
AA seq 375 aa AA seqDB search
MSSIEAVTVPKWGMTMTEGKITQWMVGEGEHVTRGQEILEIETTKVTNVVEAAATGTLRR
IVLKEGTTAPVGALAGVIAEAAATSEEIDAFIASYADRLGAGDEGDGGVPVPRTIAVDGG
AVNVLEAGPQGDETVVLLHGFGGDLSTWLFNQSALAENMRVVAIDLPGHGASSPIAGGDV
FPKIVSAVEAAVEAVAPGKLHLIAHSFGGAVAAAIAANRPSRVGSLTLIAPIGLSRQISR
DFLVDFVAAERRRPLLGVLERLFADPSKITSDMVEGTLRFKRLEGVPEALSAIADTIADD
NGQLQSIGDQLQALTCPVTLIWGERDGIVPVPQQAEVPGNVQLRIIPGAGHMPQMEASSA
VNEAIMENIQRSSGI
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcaatcgaggcagtcaccgttcccaaatggggaatgacgatgaccgagggcaag
atcacccagtggatggtcggcgagggcgagcatgtcacgcgcggtcaggaaatcctggag
atcgaaaccaccaaggtcaccaatgtcgtcgaagccgccgccaccggaacgctgagacgc
atcgtcctcaaagagggaacgacggcgccggtcggtgccctggccggggtgatcgccgag
gcggcggcgacgtcggaagagatcgacgccttcatcgcaagctatgccgaccggcttggt
gcaggcgacgaaggcgacggcggcgtccccgtgccgcgaacgatcgctgttgatgggggt
gccgtcaacgttctcgaagctggaccgcagggcgacgagacggtggtgctgctgcacggg
tttggcggcgatctttcgacatggctgttcaaccagtcggcactcgccgaaaacatgcgg
gtggttgccatcgacctgcccggacacggcgcgtcgtcgccgatcgcgggcggcgatgtc
ttcccgaagatcgtctctgccgtggaagcggcggtcgaagcggtcgcgcccggcaagctt
cacctcatcgcccactccttcggcggtgctgtcgccgcggcgatcgccgccaatcggccc
tcgcgcgtcggttcgctgacgctgatcgccccgatcgggctgagccgccagatcagccgg
gatttcctcgtcgacttcgttgcggcggagcgccgccgcccgctgctcggcgtattggag
cggctgttcgccgatccgtcgaagatcaccagcgacatggtcgagggaacgcttcgcttc
aagcggctcgagggtgtgccggaggcgctgtcggcgatcgccgacacgattgccgacgac
aatggccagctgcagtcgatcggcgaccagcttcaggcgttgacgtgcccggtgacgctc
atctggggcgagcgcgatgggatcgtcccggtgccgcagcaagccgaagtgcccggcaat
gtccagctgcgcatcatcccgggcgccggccacatgccgcagatggaggcatcctccgcc
gtcaacgaagccattatggagaacatccagcgatcgtcaggaatctga

DBGET integrated database retrieval system