KEGG   Sinorhizobium fredii USDA 257: USDA257_c31140Help
Entry
USDA257_c31140    CDS       T02188                                 

Gene name
cbbS
Definition
(GenBank) ribulose bisphosphate carboxylase small chain
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    USDA257_c31140 (cbbS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    USDA257_c31140 (cbbS)
Enzymes [BR:sfd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     USDA257_c31140 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3263968..3264357)
Genome map
AA seq 129 aa AA seqDB search
MRITQGCFSFLPDLTDEQITAQVEYCLGKGWAIGVEYTDDPHPRNTYWEMWGNPMFDLKD
AKGVMMELEDCRKAHAQDYIRLNAFDSSRGLETVTMSFIVNRPDNEPTLRMTRTESRGRS
QRYAWETQR
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcacccaaggatgcttctcattcctgccggacctgacggatgagcagataacg
gcacaagtggagtattgcctcggcaagggatgggcgatcggcgtcgaatataccgacgac
ccgcacccgcgcaacacctactgggagatgtggggcaatccgatgttcgacctcaaggac
gccaagggcgtgatgatggaattggaggattgccgcaaggctcacgcacaggattacatc
cgcctcaacgccttcgattccagccgcggcttggaaaccgtgacgatgtccttcatcgtc
aaccgtcccgacaacgagccgacactgcggatgacccggacggagagccgcggtcgcagc
caacgctatgcctgggaaacgcagcggtag

DBGET integrated database retrieval system