KEGG   Sinorhizobium fredii USDA 257: USDA257_c55770Help
Entry
USDA257_c55770    CDS       T02188                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 componentSucA
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    USDA257_c55770 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    USDA257_c55770 (sucA)
   00380 Tryptophan metabolism
    USDA257_c55770 (sucA)
Enzymes [BR:sfd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     USDA257_c55770 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(5790539..5793535)
Genome map
AA seq 998 aa AA seqDB search
MTRQEANEQFQLTSFLDGANAAYIEQLYARYEADPSSVSAEWQSFFKALADRPEDVVKAA
KGASWKKKNWPIAANGELVSALDGDWGTVEKVVEKKVKAKAEEAAAATGVPVSEAEVHQS
TRDSVRAIMMIRAYRMRGHLHAKLDPLGLADPVEDYDELAPKTYGFEEKDYDRKIFIDNV
LGLEYATVREMVEILERTYCSTMGVEFMHMSNPEEKAWIQERIEGPDKGVEFTPEGKRAI
LQKLIEAEGFEQFIDVKYKGTKRFGLDGGESLIPALEQLIKRGGQLGLKEIVLGMAHRGR
LNVLSQVMAKPHRAIFHEFKGGSYAPDDVEGSGDVKYHLGASSDREFDGNKVHLSLTANP
SHLEIVNPVVMGKARAKQDQMATVFEGDIIPLRERVKVMPLLLHGDAAFAGQGVIAEILG
LSGLRGHRVAGTVHFIINNQIGFTTNPAFSRSSPYPSDVAKMIEAPIFHVNGDDPEAVVY
AAKVATEFRMKFHKPVVVDMFCYRRFGHNEGDEPAFTQPKMYKAIRAHKTVVQVYSERLV
AEGLMNDGEVEKMKADWRARLEQEFEAGQSYKPNKADWLDGAWSGLRTADNQDEQRRGRT
SVPMKQLKEVGRKISEIPAGFSAHRTIQRFMENRANMVQTGEGIDWAMAEALAFGTLVTE
GTKIRLSGQDCERGTFSQRHSVLYDQETEERYIPLANLSPTQARYEVINSMLSEEAVLGF
EYGYSLARPNALTLWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPHGYEGQGP
EHSSARLERFLQLCAEDNMQVANVTTPANYFHILRRQVKRDFRKPLILMTPKSLLRHKRA
VSSLSEMAGESSFHRLLWDDAEVIKDGPIKLQKDSKIRRVVMCSGKVYYDLLEEREKRGI
DDIYLLRVEQLYPFPAKALINELSRFRHAEMVWCQEEPKNMGAWSFIDPYLEWVLAHIDA
KYQRVRYTGRPAAASPATGLMSKHMAQLNAFLEDALGG
NT seq 2997 nt NT seq  +upstreamnt  +downstreamnt
atgacaaggcaagaggccaacgagcaattccagctcacttcgtttctggacggcgccaac
gccgcctatatcgagcagctctatgcgcgctatgaagcggacccgtcgtccgtttcggcc
gaatggcagtccttcttcaaggcacttgccgacaggcccgaagatgtggtgaaggcagcc
aagggagcctcctggaagaagaagaactggccgatcgccgccaatggcgaactcgtctcc
gcgctcgacggcgattggggcaccgtcgaaaaggtcgtcgagaagaaggtcaaggcgaag
gcggaggaagccgctgccgcgaccggcgtgccggtcagcgaggccgaggttcatcaatcg
acgcgcgattccgtccgcgccatcatgatgatccgcgcctatcgcatgcgcggccacctg
catgccaagctcgacccgttgggcctcgccgatccggtcgaggattacgacgagctcgca
ccgaaaacctatggtttcgaagagaaggactacgaccgcaagatcttcatcgacaacgtg
cttgggctcgaatacgcgaccgtgcgcgaaatggtcgaaatcctcgagcgaacctattgc
tcgacgatgggcgtcgaattcatgcatatgtccaaccctgaggagaaggcctggatccag
gagcggatcgagggaccggacaagggcgtcgaattcacgcctgagggcaagcgggcaatc
ctgcagaagctgatcgaggcggaaggcttcgagcagttcatcgacgtcaagtacaagggc
accaagcgcttcggcctcgacggcggcgagtcgctcattccggcgctcgaacagctcatc
aagcgcggcggccagctcggtctcaaggagatcgttctcggcatggcccatcgcggccgc
ctcaacgtcctctcccaagtcatggccaagccgcaccgcgccatcttccacgagttcaag
ggcggctcctatgcgccggacgacgtcgaaggctcgggcgacgtcaagtaccacctcggc
gcttcctccgaccgcgaattcgacggcaacaaggtgcacctgtcgctgacggcgaacccg
tcgcatctggagatcgtcaacccggtcgtcatgggcaaggcgcgcgccaagcaggaccag
atggcgaccgtgttcgagggcgacatcattccgctgcgcgaacgcgtcaaggtcatgccg
ctgctgctgcatggcgacgcggccttcgccggccagggcgtcatcgcagaaatcctcggt
ctctccggtttgcgcggccaccgcgttgccggtaccgtgcacttcatcatcaataaccag
atcggcttcaccacgaacccggccttctctcggtcctcgccctatccttcggacgtggcg
aagatgatcgaagcgccgatcttccacgtgaatggcgatgacccggaagccgtggtctac
gcggccaaggttgcgactgagttccggatgaagttccacaagccggtcgtcgtcgacatg
ttctgctatcgccgcttcggccacaacgagggcgacgagccggcgttcacccagccgaag
atgtacaaggccattcgcgcccacaagacggtcgtccaggtctattcggaaaggctggtc
gccgaaggactcatgaacgacggcgaggtcgagaagatgaaggccgactggcgcgctcgt
ctcgagcaggagttcgaggccggccagtcctacaagccgaacaaggccgattggctcgac
ggtgcctggtcgggcctgcgcaccgccgacaaccaggatgagcagcgccgcggccggacc
tcggtgccgatgaagcagctgaaggaagtcggccgcaagatctccgagatcccggctggc
ttcagcgcgcatcgcaccatccagcgcttcatggagaaccgcgccaacatggtccagacc
ggcgagggtatcgactgggcgatggcggaagcgctcgccttcggaacgctcgtcaccgag
ggcacgaagatccgcctatcgggccaggactgcgagcgcggcacgttctcgcagcgccac
tcggtcctctacgatcaggagaccgaggaacgctacattccgctcgccaacctgtcgcct
acccaggcgcgctacgaggtcatcaactcgatgctctcggaagaggcggtgctcggcttc
gaatacggctattcgcttgcccgtccgaacgcgctgacgctgtgggaagcccagttcggc
gacttcgccaacggcgctcaggtggttttcgaccagttcatctcgtccggcgagcgcaag
tggctgcgcatgtccggcctcgtctgcctgctgccgcacggctatgaaggccagggaccg
gagcactcctccgcgcgtctcgaacggtttctgcagctctgcgcggaagacaacatgcag
gtcgccaacgtcacgacgccggcaaactacttccacatcctgcgccgccaggtgaagcgc
gacttccgcaagccgctgatcctgatgacgccgaaatcgctgctgcgccacaagcgggcg
gtctccagcctgtcggaaatggccggcgagagctccttccaccggctgctgtgggacgac
gccgaggtcatcaaggacggcccgatcaagctgcagaaggattcgaagatccgtcgcgtc
gtgatgtgctcgggcaaggtctattacgatcttctcgaagagcgcgagaagcgcggcatc
gacgacatctatctgctccgcgtcgagcagctctacccgttcccggcgaaagcgctcatc
aatgagctcagccgcttccgccacgcggagatggtctggtgccaggaagagccgaagaac
atgggcgcctggtcgttcatcgacccctacctcgaatgggttcttgcccatatcgacgcc
aagtatcagcgggtgcgctacaccggccgtccggccgccgcttccccggcgacgggcctg
atgtccaagcacatggcgcagctcaacgccttcctcgaggatgcgctggggggctga

DBGET integrated database retrieval system