KEGG   Sinorhizobium fredii HH103: SFHH103_03159Help
Entry
SFHH103_03159     CDS       T01731                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SFHH103_03159 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    SFHH103_03159 (sucA)
   00380 Tryptophan metabolism
    SFHH103_03159 (sucA)
Enzymes [BR:sfh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     SFHH103_03159 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3420564..3423776)
Genome map
AA seq 1070 aa AA seqDB search
MPPQWSHERHDDRAVGRDESGEAPHPRTDRRKPGLMRLTFRRPSRSGRQANMTGTTRHPN
LESGGGPSPRETMTRQEANEQFQLTSFLDGANAAYIEQLYARYEADPASVSAEWQSFFKA
LADRPEDVVKAAKGASWKKKNWPIAANGELVSALDGDWGTVEKIVEKKVKAKAEEAAVAT
GVPVSEAEVHQSTRDSVRAIMMIRAYRMRGHLHAKLDPLGLADPVEDYDELSPKTYGFEE
KDYDRRIFLDNVLGLQYGTVREMVEILERTYCSTMGVEFMHMSNPEEKAWIQERIEGPDK
GVEFTPEGKRAILQKLIEAEGFEQFIDVRYKGTKRFGLDGGESLIPALEQLIKRGGQLGL
KEIVLGMAHRGRLNVLSQVMAKPHRAIFHEFKGGSYAPDEVEGSGDVKYHLGASSDREFD
GNKVHLSLTANPSHLEIVNPVVMGKARAKQDQMATVFEGDIIPLRERVKVMPLLLHGDAA
FAGQGVIAEILGLSGLRGHRVAGTVHFIINNQIGFTTNPAFSRSSPYPSDVAKMIEAPIF
HVNGDDPEAVVYAAKVATEFRMKFHKPVVVDMFCYRRFGHNEGDEPAFTQPKMYKAIRAH
KTVVQVYSQRLIAEGLMNEGDVERMKADWRAHLEQEFEAGQSYKPNKADWLDGVWSGLRT
ADNQDEQRRGRTSVPMKQLKEIGRKLSEIPAGFNAHRTIQRFMENRANMVQTGEGIDWAM
AEALAFGTLVSEGTKIRLSGQDCERGTFSQRHSVLYDQESEERYIPLANLSPTQARYEVI
NSMLSEEAVLGFEYGYSLARPNALTLWEAQFGDFANGAQVVFDQFVSSGERKWLRMSGLV
CLLPHGYEGQGPEHSSARLERFLQLCAEDNMQVANVTTPANYFHILRRQVKRDFRKPLIL
MTPKSLLRHKRAISSLSEMAGESSFHRLLWDDAEVIKDGPIKLQKDSKIRRVVLCTGKVY
YDLLEEREKRGIDDIYLLRVEQLYPFPAKALINELSRFRHAEMVWCQEEPKNMGAWSFID
PYLEWVLAHIDAKYQRVRYTGRPAAASPATGLMSKHMAQLNAFLEDALGG
NT seq 3213 nt NT seq  +upstreamnt  +downstreamnt
gtgccgccccaatggagccacgaacgacacgatgatcgagcggtcgggcgagacgagagt
ggcgaagcgccgcatccccgcaccgaccgacgcaagccgggactgatgcgtctgaccttt
cgaaggccatcccgatccgggcgccaggcaaacatgaccgggacaacccggcatcccaac
ttagagtcaggaggcggaccaagtccgcgagagaccatgacaaggcaagaggccaacgag
caattccagctcacttcgtttctggacggcgccaatgccgcctatatcgagcagctctat
gcacgctatgaagcggacccggcgtccgtttcggccgaatggcagtccttcttcaaggcg
cttgccgacaggcccgaagatgtggtgaaggcggccaagggggcctcctggaagaagaaa
aattggccgatcgccgccaatggcgaactcgtctccgcgctcgacggggattggggcacc
gtcgaaaagatcgtcgagaagaaggtcaaggcgaaggccgaggaagcggccgtcgcgacc
ggcgttccggtcagcgaggccgaggttcatcagtcgacgcgcgattccgtccgcgccatc
atgatgatccgcgcctaccgcatgcgcggccacctgcatgccaagctcgacccgctcggc
cttgccgatccggtcgaggattacgacgagctttccccgaagacctacggcttcgaagag
aaggattacgatcgcaggatcttcctcgataacgtgctcgggctccaatacggcaccgtg
cgcgagatggtcgagatcctcgagcggacctattgctcgacgatgggcgtcgaattcatg
cacatgtccaatccggaggagaaggcctggatccaggagcggatcgagggaccggacaag
ggcgtcgagttcacccccgagggcaagcgggcaatcctgcagaagcttatcgaggcggaa
ggcttcgagcagttcatcgacgtcaggtacaagggcaccaagcgcttcggtctcgacggc
ggcgagtcgctcattccggcgctcgagcagctcatcaagcgcggcggccagcttggcctc
aaggagatcgttctcggcatggcccatcgcggccgcctcaacgtgctctcccaggtcatg
gccaagccgcaccgcgccatcttccatgagttcaagggcggctcctatgcgccggacgag
gtggaaggctcgggcgacgtcaagtatcacctcggcgcctcctccgaccgggaattcgac
ggcaacaaggtgcacctgtcgctgacggcgaacccctcgcatctcgagatcgtcaacccg
gtcgtcatgggcaaggcgcgggccaagcaggaccagatggcgaccgtcttcgagggcgac
atcattccgttgcgtgaacgcgtcaaggtcatgccgcttctgctgcacggcgacgcggcc
ttcgccggccagggcgttatcgcagaaatcctcggtctctctggtctgcgcggccaccgc
gttgccggtaccgtgcatttcatcatcaacaaccagatcggctttaccaccaacccggcc
ttctctcggtcctcgccctatccttcggacgtggcgaagatgatcgaagcgccgatcttc
cacgtgaacggcgatgacccggaagccgtcgtctatgcggccaaggtcgcgaccgagttc
cggatgaagttccacaagccggtcgtcgtcgacatgttctgctaccgccgcttcggtcac
aacgagggcgacgagccggcgttcacgcagccgaagatgtacaaggccatccgcgcccac
aagaccgtcgtccaggtctattcgcagcggctcatcgccgaaggtctcatgaacgagggc
gatgtggagaggatgaaggccgactggcgcgcccatctcgagcaggaattcgaggccggc
cagtcctacaagccgaacaaggccgactggcttgacggcgtatggtcgggcctgcgcacc
gccgacaatcaggacgagcagcgccgtggccggacgtccgtgccgatgaagcagctcaag
gaaatcggccgcaagctctccgaaatcccggccggcttcaacgcgcatcgcaccatccag
cgcttcatggaaaaccgcgccaacatggtccagaccggcgaggggatcgactgggcgatg
gcggaagcgctcgccttcgggacgctcgtcagcgagggcacgaagatccgcctgtcgggc
caggattgcgagcgcggcaccttctcgcagcgccactcggtcctctacgaccaggagagc
gaggagcgctacattccgctcgccaatctgtcgccgacccaggcgcgctacgaggtcatc
aactcgatgctctcggaagaagcggtgctcggcttcgaatacggctactcgctggcccgc
ccgaatgcgctgacgctctgggaagcccagttcggcgacttcgccaacggcgcccaggtg
gtcttcgaccagttcgtctcgtcgggcgaacgcaagtggctgcgcatgtccgggctcgtt
tgcctgctgccgcacggctatgaaggccagggaccggagcattcctcggcccgcctcgaa
cgcttcctgcagctttgcgcggaagacaacatgcaggtcgccaacgtcacgacaccggcg
aactacttccacatcctgcgccgccaggtgaagcgtgacttccgcaagccgctgatcctg
atgacgccgaagtcgctgctgcgccacaagcgggcgatctccagcctttccgagatggcc
ggcgagagctccttccaccgcctgctgtgggacgatgcggaagtcatcaaggatggcccg
atcaagctgcagaaggattcgaagatccggcgcgtcgtgctgtgcacgggcaaggtctat
tacgatcttctcgaagagcgcgagaagcgcggcatcgacgacatctatctgctgcgcgtc
gagcagctctatccgttcccggccaaggcgctcatcaacgagctcagccgcttccgccat
gcggagatggtctggtgccaggaagagccgaagaacatgggcgcctggtcgttcatcgac
ccctatctcgaatgggtgctcgcccatatcgacgccaagtatcagcgggtgcgctacacc
ggccgtccggccgccgcttcgcccgcaacgggcctgatgtccaagcacatggcgcagctc
aacgccttcctcgaggacgcgctggggggctga

DBGET integrated database retrieval system