KEGG   Streptomyces fulvissimus: SFUL_3078Help
Entry
SFUL_3078         CDS       T02650                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sfi  Streptomyces fulvissimus
Pathway
sfi00250  Alanine, aspartate and glutamate metabolism
sfi00410  beta-Alanine metabolism
sfi00430  Taurine and hypotaurine metabolism
sfi00650  Butanoate metabolism
sfi01100  Metabolic pathways
sfi01110  Biosynthesis of secondary metabolites
sfi01120  Microbial metabolism in diverse environments
sfi02024  Quorum sensing
Module
sfi_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sfi00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SFUL_3078
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SFUL_3078
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SFUL_3078
   00430 Taurine and hypotaurine metabolism
    SFUL_3078
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SFUL_3078
Enzymes [BR:sfi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SFUL_3078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AGK78014
UniProt: N0CSY9
LinkDB All DBs
Position
3498013..3499440
Genome map
AA seq 475 aa AA seqDB search
MPLHRGAHPQRDEHSDERRRLALNPFFGEADPTAAMNTAPPRHRLPDGPLPPLTAYRLVH
DELMLDGNSRLNLATFVTTWMEPQAGVLMGECQDKNMIDKDEYPRTAELERRCVAMLADL
WNAPDPAAAVGCSTTGSSEACMLAGLALKRRWAKRNADRYPATARPNLVMGVNVQVCWDK
FCNFWEVEARQVPMDGERFHLDPQAAAELCDENTIGVVGILGSTFDGSYEPIADLCAALD
ALQERTGLDIPVHVDGASGAMVAPFLDPDLEWDFRLPRVSSINTSGHKYGLVYPGVGWAL
WRTADELPEELVFRVNYLGGDMPTFALNFSRPGAQVVAQYYTFLRLGHDGYRAVQQASRD
VACSLARAVEELGDFRLLTRGDELPVFAFTTKPEVHAYDVFDVSRRLREHGWLVPAYTFP
AHREDLSVLRVVCRNGFSSDLAALLIEDLKLLLPELRAQKHPLSHDRATVTAFHH
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgccgctccaccgaggcgcccacccgcagcgggacgaacactccgacgagcggcgcagg
ctcgccctcaaccccttcttcggcgaggccgatccgacggcggcgatgaacaccgcgccg
ccccggcaccggctgccggacgggccgctgccgccgctgacggcgtaccggctggtccat
gacgagctgatgctcgacggcaactcccggctcaacctggccaccttcgtcaccacctgg
atggagccccaggccggggtgctgatgggtgagtgccaggacaagaacatgatcgacaag
gacgagtacccgcgcaccgccgagctggagcggcgctgtgtggcgatgctcgccgacctg
tggaacgcgcccgatccggcggcggccgtggggtgttcgaccaccgggtcgagcgaggcg
tgcatgctggccgggctcgccctcaagcgccgctgggccaagcggaacgcggaccgctat
ccggcgaccgcccggcccaatctggtgatgggcgtcaacgtgcaggtctgctgggacaag
ttctgcaacttctgggaggtggaggcccggcaggtcccgatggacggcgagcgcttccat
ctcgacccgcaggccgccgccgaactctgcgacgagaacacgatcggcgtcgtcggcatc
ctcggctccacctttgacggatcctacgagcccatcgccgacctctgcgcggccctggac
gccctccaggagcgcaccggccttgatatccccgtccatgtcgacggggcgtccggcgcg
atggtagcccccttcctcgatcccgatctggagtgggacttccggctgccgagagtgtcg
tccatcaacacctcgggccacaagtacgggctggtctacccaggagtcggctgggcactg
tggcgtacggcggacgagctgccggaggagctggtcttccgggtcaactacctgggcggc
gacatgccgaccttcgcgctgaacttctcccggcccggggcgcaggtggtcgcgcagtac
tacacgttcctgcgcctcgggcacgacggctaccgggcggtccagcaggcctcccgggac
gtggcctgctctctcgcccgggcggtggaggagctcggcgacttccggctgctcacccgg
ggtgacgagctgccggtcttcgccttcacgaccaagccggaggtccacgcgtacgacgtg
ttcgacgtctcgcgccggctgcgggagcacgggtggctggtcccggcctacaccttcccc
gcccaccgggaggacctttcggtgctgcgggtggtgtgccgcaacgggttctcctccgac
ctggccgcgctgctgatcgaggacctgaagctactgctccccgaactgcgggcgcagaag
cacccgttgagccatgaccgggcgaccgtgacggccttccaccactag

DBGET integrated database retrieval system